Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7058
Gene name
Locationscaffold_653:7242..9003
Strand+
Gene length (bp)1761
Transcript length (bp)1689
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 93.00 50.01 136.00
CcL In ants, during behavior modification 64.11 34.84 93.38
CcD In ants, recently dead 44.49 24.28 64.71

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.105440 no
SC16a CcD 0.000535 yes
CcL CcD 0.106625 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7058
MKAPPRLSPDYLCPAAERHLSTSLSLSAEIILSVPPELSSDFNSSRPSAMTPSLAARGITASLRSPRGSCLGRAL
PPHPSSLSPVACRCLTVHQPRRYASSDHPELPSPPTPPPRMTRLQFLVKLFRVSFQNLAVALSPRGIRSAYRDSP
ATMVMAISILAGLGLFSYWGFNFIIQTFYREEICRYPDPIANSLRRALYYSIIHPDNELALRYYKKAMEQCVEIG
FEPFSDEVLGIRIQVAGWLEKIDRHKTAAHVLETVLTDCMKWIAAMEQCVKDDKVDDAGRYRPADDEMADEMAHD
MAHDMADEKTETLWRKRQRLLRKAVGTSLKLGELYADEHVLEPDKAHAKLVWAVETSLREFQRRQRQGPKPGEQD
WLKTEELGASLESLGRDYTQRGQSQLAIPLLFRALRMCESACQRAVIMNNLAVAFAQQPLFAPEGPVKTSDDASD
GPLDTTKTPDSLMIMTRRESLEAALNWAQNAHRHAVDVQGDDRTPSCDQACAAALCTWADVAATQGKVELARAKY
GECMEMSRDIGFLPGFKHASKGIAQLDGQVKRGLARS
Coding >Ophio5|7058
ATGAAAGCCCCGCCCCGCCTTTCCCCGGACTATCTCTGCCCGGCTGCCGAGCGTCACCTCTCCACATCTCTCTCT
CTCTCTGCCGAGATAATCTTATCAGTCCCCCCGGAGCTCTCTTCAGACTTCAACTCGTCGAGACCATCAGCAATG
ACGCCCTCGTTGGCGGCCCGCGGCATCACGGCGTCTCTGCGCTCACCCCGGGGCTCGTGCCTTGGCCGCGCCTTA
CCGCCTCATCCGTCGTCTCTCAGCCCTGTCGCCTGCCGCTGCTTGACCGTCCATCAGCCACGCCGCTATGCCTCG
TCAGACCATCCCGAGCTTCCTTCTCCTCCGACGCCGCCGCCGAGGATGACGAGGCTTCAATTTCTCGTCAAGCTA
TTTCGCGTCAGCTTCCAGAACCTGGCCGTGGCATTGAGTCCGCGCGGTATCCGCTCAGCCTACCGCGACTCGCCC
GCCACCATGGTCATGGCCATCTCCATTCTTGCCGGCCTCGGGCTGTTCTCTTACTGGGGTTTCAACTTCATCATC
CAGACCTTTTACCGCGAGGAGATTTGCCGGTACCCCGACCCCATCGCCAACTCGCTGCGTCGCGCCCTCTACTAT
AGCATCATCCATCCCGATAACGAGCTGGCCCTGCGCTACTACAAAAAGGCCATGGAGCAGTGCGTCGAGATTGGA
TTCGAACCCTTCTCGGACGAGGTGCTCGGCATACGCATTCAAGTCGCCGGCTGGCTCGAGAAGATAGACAGGCAC
AAGACGGCCGCCCACGTTCTCGAGACGGTCCTGACAGACTGCATGAAGTGGATTGCCGCCATGGAACAATGTGTC
AAGGACGACAAGGTGGACGATGCCGGCAGGTACCGGCCCGCCGACGACGAGATGGCGGACGAGATGGCACACGAC
ATGGCACACGACATGGCGGACGAGAAGACGGAGACGCTATGGCGCAAGCGGCAACGGCTTTTGCGCAAGGCCGTC
GGCACCAGCCTCAAGCTCGGCGAGCTCTACGCCGACGAGCACGTGCTCGAGCCCGACAAGGCGCATGCCAAACTT
GTATGGGCCGTCGAGACGTCGCTGCGCGAGTTCCAACGGCGGCAGCGCCAGGGCCCCAAGCCGGGCGAGCAGGAC
TGGCTCAAGACGGAAGAGCTGGGTGCTTCGCTGGAGTCGCTGGGGCGAGACTACACGCAGAGAGGCCAGTCGCAG
CTAGCCATTCCCCTGCTGTTCCGTGCGTTACGCATGTGCGAAAGCGCGTGCCAGCGGGCCGTCATCATGAACAAC
CTGGCCGTCGCCTTCGCCCAGCAGCCACTGTTTGCGCCCGAGGGACCGGTCAAGACTTCCGATGACGCGTCCGAT
GGGCCGTTGGACACGACGAAGACGCCGGACTCGCTCATGATCATGACGCGCCGTGAAAGCCTCGAGGCGGCCTTG
AACTGGGCGCAAAACGCGCACAGGCACGCGGTGGACGTGCAGGGCGACGACAGGACGCCCTCGTGTGACCAGGCG
TGCGCCGCGGCGTTATGCACTTGGGCCGACGTGGCGGCGACGCAGGGCAAGGTCGAGCTGGCCCGTGCCAAGTAC
GGCGAGTGCATGGAGATGAGCCGCGACATTGGCTTTCTCCCGGGCTTTAAGCACGCCAGCAAGGGGATCGCCCAG
CTCGACGGCCAAGTCAAGCGAGGCCTGGCCAGGTCT
Transcript >Ophio5|7058
ATGAAAGCCCCGCCCCGCCTTTCCCCGGACTATCTCTGCCCGGCTGCCGAGCGTCACCTCTCCACATCTCTCTCT
CTCTCTGCCGAGATAATCTTATCAGTCCCCCCGGAGCTCTCTTCAGACTTCAACTCGTCGAGACCATCAGCAATG
ACGCCCTCGTTGGCGGCCCGCGGCATCACGGCGTCTCTGCGCTCACCCCGGGGCTCGTGCCTTGGCCGCGCCTTA
CCGCCTCATCCGTCGTCTCTCAGCCCTGTCGCCTGCCGCTGCTTGACCGTCCATCAGCCACGCCGCTATGCCTCG
TCAGACCATCCCGAGCTTCCTTCTCCTCCGACGCCGCCGCCGAGGATGACGAGGCTTCAATTTCTCGTCAAGCTA
TTTCGCGTCAGCTTCCAGAACCTGGCCGTGGCATTGAGTCCGCGCGGTATCCGCTCAGCCTACCGCGACTCGCCC
GCCACCATGGTCATGGCCATCTCCATTCTTGCCGGCCTCGGGCTGTTCTCTTACTGGGGTTTCAACTTCATCATC
CAGACCTTTTACCGCGAGGAGATTTGCCGGTACCCCGACCCCATCGCCAACTCGCTGCGTCGCGCCCTCTACTAT
AGCATCATCCATCCCGATAACGAGCTGGCCCTGCGCTACTACAAAAAGGCCATGGAGCAGTGCGTCGAGATTGGA
TTCGAACCCTTCTCGGACGAGGTGCTCGGCATACGCATTCAAGTCGCCGGCTGGCTCGAGAAGATAGACAGGCAC
AAGACGGCCGCCCACGTTCTCGAGACGGTCCTGACAGACTGCATGAAGTGGATTGCCGCCATGGAACAATGTGTC
AAGGACGACAAGGTGGACGATGCCGGCAGGTACCGGCCCGCCGACGACGAGATGGCGGACGAGATGGCACACGAC
ATGGCACACGACATGGCGGACGAGAAGACGGAGACGCTATGGCGCAAGCGGCAACGGCTTTTGCGCAAGGCCGTC
GGCACCAGCCTCAAGCTCGGCGAGCTCTACGCCGACGAGCACGTGCTCGAGCCCGACAAGGCGCATGCCAAACTT
GTATGGGCCGTCGAGACGTCGCTGCGCGAGTTCCAACGGCGGCAGCGCCAGGGCCCCAAGCCGGGCGAGCAGGAC
TGGCTCAAGACGGAAGAGCTGGGTGCTTCGCTGGAGTCGCTGGGGCGAGACTACACGCAGAGAGGCCAGTCGCAG
CTAGCCATTCCCCTGCTGTTCCGTGCGTTACGCATGTGCGAAAGCGCGTGCCAGCGGGCCGTCATCATGAACAAC
CTGGCCGTCGCCTTCGCCCAGCAGCCACTGTTTGCGCCCGAGGGACCGGTCAAGACTTCCGATGACGCGTCCGAT
GGGCCGTTGGACACGACGAAGACGCCGGACTCGCTCATGATCATGACGCGCCGTGAAAGCCTCGAGGCGGCCTTG
AACTGGGCGCAAAACGCGCACAGGCACGCGGTGGACGTGCAGGGCGACGACAGGACGCCCTCGTGTGACCAGGCG
TGCGCCGCGGCGTTATGCACTTGGGCCGACGTGGCGGCGACGCAGGGCAAGGTCGAGCTGGCCCGTGCCAAGTAC
GGCGAGTGCATGGAGATGAGCCGCGACATTGGCTTTCTCCCGGGCTTTAAGCACGCCAGCAAGGGGATCGCCCAG
CTCGACGGCCAAGTCAAGCGAGGCCTGGCCAGGTCTTGA
Gene >Ophio5|7058
ATGAAAGCCCCGCCCCGCCTTTCCCCGGACTATCTCTGCCCGGCTGCCGAGCGTCACCTCTCCACATCTCTCTCT
CTCTCTGCCGAGATAATCTTATCAGTCCCCCCGGAGCTCTCTTCAGACTTCAACTCGTCGAGACCATCAGCAATG
ACGCCCTCGTTGGCGGCCCGCGGCATCACGGCGTCTCTGCGCTCACCCCGGGGCTCGTGCCTTGGCCGCGCCTTA
CCGCCTCATCCGTCGTCTCTCAGCCCTGTCGCCTGCCGCTGCTTGACCGTCCATCAGCCACGCCGCTATGCCTCG
TCAGACCATCCCGAGCTTCCTTCTCCTCCGACGCCGCCGCCGAGGATGACGAGGCTTCAATTTCTCGTCAAGCTA
TTTCGCGTCAGCTTCCAGAACCTGGCCGTGGCATTGAGTCCGCGCGGTATCCGCTCAGCCTACCGCGACTCGCCC
GCCACCATGGTCATGGCCATCTCCATGTGAGTCGACGCGACTTCGACTGAGGACCAAAGTTGCTGATATGAGCTG
GGGGATCGAAAAAAAAAAAAAAGTCTTGCCGGCCTCGGGCTGTTCTCTTACTGGGGTTTCAACTTCATCATCCAG
ACCTTTTACCGCGAGGAGATTTGCCGGTACCCCGACCCCATCGCCAACTCGCTGCGTCGCGCCCTCTACTATAGC
ATCATCCATCCCGATAACGAGCTGGCCCTGCGCTACTACAAAAAGGCCATGGAGCAGTGCGTCGAGATTGGATTC
GAACCCTTCTCGGACGAGGTGCTCGGCATACGCATTCAAGTCGCCGGCTGGCTCGAGAAGATAGACAGGCACAAG
ACGGCCGCCCACGTTCTCGAGACGGTCCTGACAGACTGCATGAAGTGGATTGCCGCCATGGAACAATGTGTCAAG
GACGACAAGGTGGACGATGCCGGCAGGTACCGGCCCGCCGACGACGAGATGGCGGACGAGATGGCACACGACATG
GCACACGACATGGCGGACGAGAAGACGGAGACGCTATGGCGCAAGCGGCAACGGCTTTTGCGCAAGGCCGTCGGC
ACCAGCCTCAAGCTCGGCGAGCTCTACGCCGACGAGCACGTGCTCGAGCCCGACAAGGCGCATGCCAAACTTGTA
TGGGCCGTCGAGACGTCGCTGCGCGAGTTCCAACGGCGGCAGCGCCAGGGCCCCAAGCCGGGCGAGCAGGACTGG
CTCAAGACGGAAGAGCTGGGTGCTTCGCTGGAGTCGCTGGGGCGAGACTACACGCAGAGAGGCCAGTCGCAGCTA
GCCATTCCCCTGCTGTTCCGTGCGTTACGCATGTGCGAAAGCGCGTGCCAGCGGGCCGTCATCATGAACAACCTG
GCCGTCGCCTTCGCCCAGCAGCCACTGTTTGCGCCCGAGGGACCGGTCAAGACTTCCGATGACGCGTCCGATGGG
CCGTTGGACACGACGAAGACGCCGGACTCGCTCATGATCATGACGCGCCGTGAAAGCCTCGAGGCGGCCTTGAAC
TGGGCGCAAAACGCGCACAGGCACGCGGTGGACGTGCAGGGCGACGACAGGACGCCCTCGTGTGACCAGGCGTGC
GCCGCGGCGTTATGCACTTGGGCCGACGTGGCGGCGACGCAGGGCAAGGTCGAGCTGGCCCGTGCCAAGTACGGC
GAGTGCATGGAGATGAGCCGCGACATTGGCTTTCTCCCGGGCTTTAAGCACGCCAGCAAGGGGATCGCCCAGCTC
GACGGCCAAGTCAAGCGAGGCCTGGCCAGGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail