Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7051
Gene name
Locationscaffold_652:250..2565
Strand+
Gene length (bp)2315
Transcript length (bp)1896
Coding sequence length (bp)1893
Protein length (aa) 631

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.6E-05 364 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 273 495 7.0E-57
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 311 454 5.0E-25
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 311 454 9.0E-25
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 324 443 1.0E-24
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 327 443 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 273 495 7.0E-57
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 311 454 5.0E-25
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 311 454 9.0E-25
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 324 443 1.0E-24
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 327 443 1.0E-24
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 327 447 4.0E-24
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 331 450 4.0E-24
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 331 447 7.0E-24
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 321 454 2.0E-23
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 317 454 2.0E-23
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 321 454 2.0E-23
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 317 454 3.0E-23
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 286 454 3.0E-23
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 317 454 4.0E-23
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 311 454 4.0E-23
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 341 443 5.0E-23
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 331 447 5.0E-23
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 331 447 5.0E-23
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 341 443 6.0E-23
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 341 443 8.0E-23
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 296 443 1.0E-22
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 341 443 1.0E-22
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 334 442 1.0E-22
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 334 443 2.0E-22
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 327 447 2.0E-22
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 336 450 2.0E-22
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 283 443 2.0E-22
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 335 481 4.0E-22
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 337 443 5.0E-22
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 327 447 5.0E-22
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 337 443 5.0E-22
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 341 443 6.0E-22
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 341 443 7.0E-22
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 337 443 8.0E-22
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 337 443 9.0E-22
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 341 443 1.0E-21
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 341 443 1.0E-21
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 336 443 1.0E-21
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 291 443 1.0E-21
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 337 443 1.0E-21
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 309 443 1.0E-21
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 341 455 2.0E-21
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 337 442 2.0E-21
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 339 444 2.0E-21
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 337 443 2.0E-21
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 341 443 2.0E-21
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 341 443 2.0E-21
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 341 443 2.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 334 443 2.0E-21
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 339 444 2.0E-21
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 337 443 2.0E-21
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 2.0E-21
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 334 443 2.0E-21
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 341 442 3.0E-21
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 442 3.0E-21
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 339 444 3.0E-21
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 334 442 3.0E-21
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 341 443 3.0E-21
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 341 443 3.0E-21
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 341 443 3.0E-21
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 341 443 3.0E-21
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 330 443 4.0E-21
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 341 443 4.0E-21
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 341 442 4.0E-21
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 334 455 4.0E-21
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 341 449 4.0E-21
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 341 449 4.0E-21
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 341 483 4.0E-21
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 291 443 5.0E-21
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 442 5.0E-21
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 341 447 5.0E-21
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 337 442 5.0E-21
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 337 443 5.0E-21
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 341 443 5.0E-21
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 322 443 5.0E-21
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 341 449 5.0E-21
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 341 443 6.0E-21
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 341 449 6.0E-21
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 341 443 6.0E-21
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 341 449 6.0E-21
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 337 443 7.0E-21
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 334 452 7.0E-21
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 337 443 7.0E-21
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 341 443 7.0E-21
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 334 452 7.0E-21
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 292 442 7.0E-21
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 341 443 7.0E-21
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 334 452 8.0E-21
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 308 442 8.0E-21
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 337 443 9.0E-21
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 341 443 9.0E-21
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 335 443 9.0E-21
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 329 443 9.0E-21
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 334 443 9.0E-21
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 336 443 1.0E-20
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 341 443 1.0E-20
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 329 442 1.0E-20
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 341 455 1.0E-20
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 334 443 1.0E-20
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 334 443 1.0E-20
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 325 443 1.0E-20
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 341 443 1.0E-20
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 341 483 1.0E-20
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 341 443 1.0E-20
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 339 444 1.0E-20
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 331 442 1.0E-20
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 337 443 1.0E-20
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 321 443 1.0E-20
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 327 442 1.0E-20
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 331 457 1.0E-20
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 331 435 1.0E-20
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 331 442 1.0E-20
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 336 443 2.0E-20
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 337 449 2.0E-20
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 331 457 2.0E-20
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 331 457 2.0E-20
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 331 457 2.0E-20
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 341 443 2.0E-20
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 334 443 2.0E-20
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 334 443 2.0E-20
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 334 443 2.0E-20
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 341 447 2.0E-20
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 271 443 2.0E-20
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 341 442 2.0E-20
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 449 2.0E-20
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 341 495 2.0E-20
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 337 443 2.0E-20
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 331 442 3.0E-20
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 331 445 3.0E-20
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 331 443 3.0E-20
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 334 443 3.0E-20
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 341 456 3.0E-20
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 335 443 3.0E-20
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 337 443 3.0E-20
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 334 443 3.0E-20
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 334 443 3.0E-20
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 334 442 3.0E-20
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 3.0E-20
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 280 443 3.0E-20
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 340 443 4.0E-20
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 341 443 4.0E-20
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 341 452 4.0E-20
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 341 443 4.0E-20
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 337 443 4.0E-20
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 4.0E-20
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 4.0E-20
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 336 445 4.0E-20
sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens GN=REPIN1 PE=1 SV=1 341 481 4.0E-20
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 331 451 4.0E-20
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 341 443 4.0E-20
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 331 421 4.0E-20
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 341 452 4.0E-20
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 341 443 4.0E-20
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 341 442 4.0E-20
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 309 442 4.0E-20
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 331 421 4.0E-20
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 341 449 4.0E-20
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 341 443 5.0E-20
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 341 449 5.0E-20
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 341 443 5.0E-20
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 5.0E-20
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 337 443 5.0E-20
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 341 443 5.0E-20
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 331 442 6.0E-20
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 340 443 6.0E-20
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 341 443 6.0E-20
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 339 444 6.0E-20
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 332 443 6.0E-20
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 331 443 7.0E-20
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 341 443 7.0E-20
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 334 443 7.0E-20
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 341 442 7.0E-20
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 341 443 7.0E-20
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 321 443 7.0E-20
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 341 443 7.0E-20
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 341 449 7.0E-20
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 334 450 7.0E-20
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 332 583 7.0E-20
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 341 449 8.0E-20
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 341 443 8.0E-20
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 334 443 8.0E-20
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 337 443 8.0E-20
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 341 443 8.0E-20
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 341 443 8.0E-20
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 319 443 8.0E-20
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 341 443 9.0E-20
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 9.0E-20
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 341 481 9.0E-20
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 9.0E-20
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 334 488 9.0E-20
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 321 443 9.0E-20
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 443 9.0E-20
sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus GN=REPIN1 PE=2 SV=1 341 481 9.0E-20
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 334 452 9.0E-20
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 341 481 1.0E-19
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 341 455 1.0E-19
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 341 443 1.0E-19
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 447 1.0E-19
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 443 1.0E-19
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 339 443 1.0E-19
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 341 443 1.0E-19
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 334 452 1.0E-19
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 340 444 1.0E-19
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 337 443 1.0E-19
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 334 452 1.0E-19
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 341 442 1.0E-19
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 341 445 1.0E-19
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 334 443 1.0E-19
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 341 442 1.0E-19
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 331 433 1.0E-19
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 340 449 1.0E-19
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 334 488 1.0E-19
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 329 443 1.0E-19
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 341 442 1.0E-19
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 332 443 1.0E-19
sp|Q5U4E2|REPI1_MOUSE Replication initiator 1 OS=Mus musculus GN=Repin1 PE=1 SV=1 341 481 1.0E-19
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 341 442 1.0E-19
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 331 443 1.0E-19
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 341 451 1.0E-19
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 341 489 1.0E-19
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 324 442 1.0E-19
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 341 445 1.0E-19
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 337 443 2.0E-19
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 334 443 2.0E-19
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 306 443 2.0E-19
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 334 481 2.0E-19
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 443 2.0E-19
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 447 2.0E-19
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 337 443 2.0E-19
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 341 443 2.0E-19
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 331 451 2.0E-19
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 334 443 2.0E-19
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 334 443 2.0E-19
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 331 443 2.0E-19
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 337 443 2.0E-19
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 325 461 2.0E-19
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 341 489 2.0E-19
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 2.0E-19
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 331 443 2.0E-19
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 2.0E-19
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 323 442 2.0E-19
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 331 443 2.0E-19
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 331 443 2.0E-19
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 341 443 2.0E-19
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 331 443 2.0E-19
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 331 443 2.0E-19
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 324 442 2.0E-19
sp|Q68H95|REPI1_RAT Replication initiator 1 OS=Rattus norvegicus GN=Repin1 PE=2 SV=1 341 481 2.0E-19
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 443 2.0E-19
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 330 442 2.0E-19
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 341 442 2.0E-19
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 331 443 2.0E-19
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 324 442 2.0E-19
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 330 442 2.0E-19
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 2.0E-19
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 341 443 2.0E-19
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 341 443 2.0E-19
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 443 2.0E-19
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 330 442 2.0E-19
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 330 442 2.0E-19
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 341 443 3.0E-19
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 341 443 3.0E-19
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 337 442 3.0E-19
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 337 442 3.0E-19
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 331 443 3.0E-19
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 331 438 3.0E-19
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 334 443 3.0E-19
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 330 443 3.0E-19
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 331 443 3.0E-19
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 313 443 3.0E-19
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 340 449 3.0E-19
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 335 445 3.0E-19
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 325 481 3.0E-19
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 341 449 3.0E-19
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 3.0E-19
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 331 442 3.0E-19
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 3.0E-19
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 331 442 3.0E-19
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 331 442 4.0E-19
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 328 443 4.0E-19
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 341 443 4.0E-19
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 337 443 4.0E-19
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 341 442 4.0E-19
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 323 442 4.0E-19
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 339 495 4.0E-19
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 334 442 4.0E-19
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 337 443 4.0E-19
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 313 442 4.0E-19
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 334 442 4.0E-19
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 341 443 4.0E-19
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 324 443 5.0E-19
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 341 443 5.0E-19
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 334 442 5.0E-19
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 331 443 5.0E-19
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 331 443 5.0E-19
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 334 443 5.0E-19
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 331 443 5.0E-19
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 334 443 5.0E-19
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 325 449 5.0E-19
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 341 443 5.0E-19
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 334 442 6.0E-19
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 340 443 6.0E-19
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 340 443 6.0E-19
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 341 442 6.0E-19
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 341 443 6.0E-19
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 341 443 6.0E-19
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 334 443 6.0E-19
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 325 442 6.0E-19
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 443 6.0E-19
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 337 449 6.0E-19
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 341 443 6.0E-19
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 331 443 6.0E-19
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 337 443 6.0E-19
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 296 443 6.0E-19
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 341 443 6.0E-19
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 165 443 6.0E-19
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 331 445 7.0E-19
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 337 443 7.0E-19
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 334 443 7.0E-19
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 331 445 7.0E-19
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 331 443 7.0E-19
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 341 481 7.0E-19
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 443 7.0E-19
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 341 442 8.0E-19
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 443 8.0E-19
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 341 442 8.0E-19
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 334 442 8.0E-19
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 334 442 8.0E-19
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 341 443 8.0E-19
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 330 445 8.0E-19
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 341 459 8.0E-19
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 325 444 9.0E-19
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 337 443 9.0E-19
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 334 442 9.0E-19
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 331 444 9.0E-19
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 334 442 9.0E-19
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 334 442 9.0E-19
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 331 443 9.0E-19
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 335 443 9.0E-19
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 443 9.0E-19
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 323 442 9.0E-19
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 332 443 9.0E-19
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 331 443 9.0E-19
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 341 443 9.0E-19
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 341 443 9.0E-19
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 341 443 1.0E-18
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 341 443 1.0E-18
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 341 447 1.0E-18
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 334 442 1.0E-18
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 341 443 1.0E-18
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 341 443 1.0E-18
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 341 443 1.0E-18
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 334 449 1.0E-18
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 334 443 1.0E-18
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 341 443 1.0E-18
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 337 442 1.0E-18
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 332 443 1.0E-18
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 341 443 1.0E-18
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 341 443 1.0E-18
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 331 443 1.0E-18
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 341 443 1.0E-18
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 334 443 1.0E-18
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 334 445 1.0E-18
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 334 445 1.0E-18
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 341 443 1.0E-18
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 334 445 1.0E-18
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 334 443 1.0E-18
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 341 443 1.0E-18
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 341 443 1.0E-18
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 334 442 1.0E-18
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 329 443 1.0E-18
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 341 442 1.0E-18
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 1.0E-18
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 341 447 1.0E-18
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 334 442 1.0E-18
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 341 443 1.0E-18
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 341 442 1.0E-18
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 334 442 1.0E-18
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 340 443 1.0E-18
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 341 443 1.0E-18
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 1.0E-18
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 341 443 1.0E-18
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 302 443 1.0E-18
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 302 443 1.0E-18
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 341 442 1.0E-18
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 336 443 1.0E-18
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 296 455 1.0E-18
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 330 443 1.0E-18
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 334 443 1.0E-18
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 341 455 1.0E-18
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 339 443 1.0E-18
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 334 443 2.0E-18
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 341 443 2.0E-18
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 339 443 2.0E-18
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 334 443 2.0E-18
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 337 443 2.0E-18
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 341 443 2.0E-18
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 443 2.0E-18
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 330 445 2.0E-18
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 331 445 2.0E-18
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 341 444 2.0E-18
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 341 444 2.0E-18
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 325 447 2.0E-18
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 341 444 2.0E-18
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 341 444 2.0E-18
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 334 445 2.0E-18
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 334 443 2.0E-18
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 341 442 2.0E-18
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 329 443 2.0E-18
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 334 443 2.0E-18
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 334 443 2.0E-18
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 332 442 2.0E-18
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 341 443 2.0E-18
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 337 442 2.0E-18
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 337 443 2.0E-18
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 341 467 2.0E-18
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 331 443 2.0E-18
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 335 443 2.0E-18
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 331 442 2.0E-18
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 341 443 2.0E-18
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 336 443 2.0E-18
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 339 443 2.0E-18
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 337 443 2.0E-18
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 341 443 2.0E-18
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 334 445 2.0E-18
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 334 566 2.0E-18
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 341 443 2.0E-18
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 331 466 2.0E-18
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 308 443 2.0E-18
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 339 444 2.0E-18
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 340 443 2.0E-18
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 341 444 2.0E-18
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 325 442 2.0E-18
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 339 494 2.0E-18
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 341 481 2.0E-18
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 341 443 2.0E-18
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 332 566 2.0E-18
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 334 443 2.0E-18
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 335 454 2.0E-18
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 337 455 2.0E-18
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 341 455 2.0E-18
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 341 455 2.0E-18
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 276 443 2.0E-18
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 220 449 2.0E-18
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 328 442 2.0E-18
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 325 461 2.0E-18
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 339 444 2.0E-18
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 336 443 2.0E-18
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 335 483 2.0E-18
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 341 443 2.0E-18
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 325 443 3.0E-18
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 337 443 3.0E-18
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 339 442 3.0E-18
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 334 443 3.0E-18
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 334 443 3.0E-18
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 337 443 3.0E-18
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 337 442 3.0E-18
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 321 443 3.0E-18
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 341 443 3.0E-18
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 481 3.0E-18
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 341 442 3.0E-18
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 334 443 3.0E-18
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 334 442 3.0E-18
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 297 443 3.0E-18
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 286 443 3.0E-18
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 331 443 3.0E-18
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 341 461 3.0E-18
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 341 443 3.0E-18
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 341 443 3.0E-18
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 330 443 3.0E-18
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 337 443 3.0E-18
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 443 3.0E-18
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 341 444 3.0E-18
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 341 445 3.0E-18
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 331 466 3.0E-18
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 331 443 3.0E-18
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 334 444 3.0E-18
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 329 443 3.0E-18
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 332 442 3.0E-18
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 341 443 3.0E-18
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 325 461 3.0E-18
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 339 443 3.0E-18
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 329 443 3.0E-18
sp|Q02085|SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus GN=Snai1 PE=1 SV=1 329 445 3.0E-18
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 337 443 3.0E-18
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 337 455 3.0E-18
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 290 445 3.0E-18
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 331 447 3.0E-18
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 334 443 3.0E-18
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 335 443 3.0E-18
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 341 435 3.0E-18
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 325 443 4.0E-18
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 314 443 4.0E-18
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 341 443 4.0E-18
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 341 443 4.0E-18
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 341 443 4.0E-18
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 341 443 4.0E-18
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 341 443 4.0E-18
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 4.0E-18
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 341 442 4.0E-18
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 334 443 4.0E-18
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 335 443 4.0E-18
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 331 443 4.0E-18
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 341 481 4.0E-18
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 330 445 4.0E-18
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 334 443 4.0E-18
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 4.0E-18
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 336 443 4.0E-18
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 336 443 4.0E-18
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 337 481 4.0E-18
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 341 435 4.0E-18
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 325 461 4.0E-18
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 334 443 4.0E-18
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 341 481 4.0E-18
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 335 442 4.0E-18
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 332 442 4.0E-18
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 336 444 4.0E-18
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 331 443 4.0E-18
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 341 443 4.0E-18
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 4.0E-18
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 339 481 4.0E-18
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 341 443 4.0E-18
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 341 443 5.0E-18
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 337 443 5.0E-18
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 341 443 5.0E-18
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 339 442 5.0E-18
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 337 443 5.0E-18
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 341 451 5.0E-18
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 341 450 5.0E-18
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 332 443 5.0E-18
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 341 449 5.0E-18
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 341 443 5.0E-18
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 327 443 5.0E-18
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 341 481 5.0E-18
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 341 443 5.0E-18
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 341 461 5.0E-18
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 332 442 5.0E-18
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 330 445 5.0E-18
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 341 481 5.0E-18
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 332 442 5.0E-18
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 336 443 5.0E-18
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 283 459 5.0E-18
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 443 5.0E-18
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 331 416 5.0E-18
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 341 449 5.0E-18
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 341 449 5.0E-18
sp|P18728|ZG53_XENLA Gastrula zinc finger protein XlCGF53.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 442 5.0E-18
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 341 442 5.0E-18
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 332 442 5.0E-18
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 341 443 5.0E-18
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 341 443 5.0E-18
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 341 443 5.0E-18
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 341 443 5.0E-18
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 341 443 5.0E-18
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 327 442 6.0E-18
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 341 443 6.0E-18
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 337 442 6.0E-18
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 341 443 6.0E-18
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 341 451 6.0E-18
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 341 443 6.0E-18
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 341 443 6.0E-18
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 341 443 6.0E-18
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 334 448 6.0E-18
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 481 6.0E-18
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 341 444 6.0E-18
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 341 447 6.0E-18
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 331 447 6.0E-18
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 6.0E-18
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 336 443 6.0E-18
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 337 443 6.0E-18
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 325 481 6.0E-18
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 330 443 6.0E-18
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 341 451 6.0E-18
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 341 495 6.0E-18
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 341 443 6.0E-18
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 328 442 6.0E-18
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 334 443 7.0E-18
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 337 443 7.0E-18
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 341 443 7.0E-18
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 341 443 7.0E-18
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 337 443 7.0E-18
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 337 443 7.0E-18
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 337 442 7.0E-18
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 339 445 7.0E-18
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 313 443 7.0E-18
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 443 7.0E-18
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 341 443 7.0E-18
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 334 443 7.0E-18
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 334 443 7.0E-18
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 340 453 7.0E-18
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 341 451 7.0E-18
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 341 442 7.0E-18
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 341 443 7.0E-18
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 341 443 7.0E-18
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 341 443 7.0E-18
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 341 443 7.0E-18
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 332 464 7.0E-18
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 341 443 8.0E-18
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 341 481 8.0E-18
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 340 443 8.0E-18
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 331 443 8.0E-18
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 331 443 8.0E-18
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 337 443 8.0E-18
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 8.0E-18
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 334 443 8.0E-18
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 341 443 8.0E-18
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 308 443 8.0E-18
sp|Q9H9D4|ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens GN=ZNF408 PE=1 SV=1 297 445 8.0E-18
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 341 443 8.0E-18
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 341 449 8.0E-18
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 341 443 9.0E-18
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 337 442 9.0E-18
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 341 444 9.0E-18
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 341 451 9.0E-18
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 313 443 9.0E-18
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 337 443 9.0E-18
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 341 443 9.0E-18
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 442 9.0E-18
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 341 442 9.0E-18
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 341 443 9.0E-18
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 327 442 9.0E-18
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 339 449 9.0E-18
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 443 9.0E-18
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 341 449 9.0E-18
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 341 449 9.0E-18
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 334 443 9.0E-18
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 341 560 1.0E-17
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 341 443 1.0E-17
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 341 444 1.0E-17
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 341 442 1.0E-17
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 341 442 1.0E-17
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 337 443 1.0E-17
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 334 444 1.0E-17
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 339 443 1.0E-17
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 341 442 1.0E-17
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 341 416 1.0E-17
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 341 443 1.0E-17
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 337 443 1.0E-17
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 341 442 1.0E-17
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 341 444 1.0E-17
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 341 442 1.0E-17
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 334 443 1.0E-17
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 341 443 1.0E-17
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 334 443 1.0E-17
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 331 443 1.0E-17
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 334 443 1.0E-17
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 443 1.0E-17
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 443 1.0E-17
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 337 442 1.0E-17
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 341 443 1.0E-17
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 332 443 1.0E-17
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 331 428 1.0E-17
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 1.0E-17
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 1.0E-17
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 337 443 1.0E-17
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 313 442 1.0E-17
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 341 481 1.0E-17
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 341 443 1.0E-17
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 275 445 1.0E-17
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 341 443 1.0E-17
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 443 1.0E-17
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 336 443 1.0E-17
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 331 443 1.0E-17
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 341 443 1.0E-17
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 339 443 1.0E-17
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 334 566 1.0E-17
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 331 443 1.0E-17
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 331 443 1.0E-17
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 331 443 1.0E-17
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 341 443 1.0E-17
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 331 447 1.0E-17
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 341 443 1.0E-17
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 331 443 1.0E-17
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 341 443 1.0E-17
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 336 448 1.0E-17
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 331 447 1.0E-17
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 341 463 1.0E-17
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 340 481 1.0E-17
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 331 442 1.0E-17
sp|Q3MHQ4|SNAI2_BOVIN Zinc finger protein SNAI2 OS=Bos taurus GN=SNAI2 PE=2 SV=1 328 445 1.0E-17
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 341 443 1.0E-17
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 337 424 1.0E-17
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 341 443 1.0E-17
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 341 442 1.0E-17
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 341 443 1.0E-17
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 341 443 1.0E-17
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 334 458 1.0E-17
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 331 443 1.0E-17
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 341 443 1.0E-17
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 341 445 1.0E-17
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 341 442 1.0E-17
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 341 443 1.0E-17
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 335 443 2.0E-17
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 341 443 2.0E-17
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 442 2.0E-17
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 341 442 2.0E-17
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 334 481 2.0E-17
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 314 443 2.0E-17
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 341 445 2.0E-17
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 334 434 2.0E-17
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 337 443 2.0E-17
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 341 442 2.0E-17
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 320 443 2.0E-17
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 341 443 2.0E-17
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 353 443 2.0E-17
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 339 445 2.0E-17
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 142 443 2.0E-17
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 341 434 2.0E-17
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 341 465 2.0E-17
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 341 443 2.0E-17
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 334 443 2.0E-17
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 334 443 2.0E-17
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 341 443 2.0E-17
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 341 443 2.0E-17
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 341 443 2.0E-17
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 334 443 2.0E-17
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 334 443 2.0E-17
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 320 443 2.0E-17
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 341 442 2.0E-17
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 331 450 2.0E-17
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 334 443 2.0E-17
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 334 443 2.0E-17
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 313 442 2.0E-17
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 341 443 2.0E-17
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 324 443 2.0E-17
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 341 443 2.0E-17
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 325 443 2.0E-17
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 341 465 2.0E-17
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 337 443 2.0E-17
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 341 443 2.0E-17
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 313 442 2.0E-17
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 331 443 2.0E-17
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 341 425 2.0E-17
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 341 443 2.0E-17
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 334 443 2.0E-17
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 341 449 2.0E-17
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 341 443 2.0E-17
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 443 2.0E-17
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 341 443 2.0E-17
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 341 443 2.0E-17
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 336 448 2.0E-17
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 341 443 2.0E-17
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 443 2.0E-17
sp|P18745|ZO22_XENLA Oocyte zinc finger protein XlCOF22 OS=Xenopus laevis PE=3 SV=1 341 481 2.0E-17
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 332 443 2.0E-17
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 331 444 2.0E-17
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 315 442 2.0E-17
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 341 466 2.0E-17
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 341 443 2.0E-17
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 341 443 2.0E-17
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 341 443 2.0E-17
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 341 442 2.0E-17
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 319 443 2.0E-17
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 341 443 2.0E-17
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 331 488 2.0E-17
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 331 443 2.0E-17
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 336 443 2.0E-17
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 2.0E-17
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 443 2.0E-17
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 337 443 2.0E-17
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 341 443 2.0E-17
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 322 443 2.0E-17
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 337 442 2.0E-17
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 335 443 2.0E-17
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 306 443 3.0E-17
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 342 443 3.0E-17
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 341 443 3.0E-17
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 341 443 3.0E-17
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 335 442 3.0E-17
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 339 481 3.0E-17
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 313 443 3.0E-17
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 334 443 3.0E-17
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 341 443 3.0E-17
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 327 481 3.0E-17
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 3.0E-17
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 339 443 3.0E-17
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 337 442 3.0E-17
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 325 443 3.0E-17
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 341 442 3.0E-17
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 341 443 3.0E-17
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 341 442 3.0E-17
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 331 449 3.0E-17
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 341 443 3.0E-17
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 3.0E-17
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 339 449 3.0E-17
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 322 444 3.0E-17
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 332 442 3.0E-17
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 3.0E-17
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 341 443 3.0E-17
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 443 3.0E-17
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 325 481 3.0E-17
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 334 442 3.0E-17
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 329 442 3.0E-17
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 334 443 3.0E-17
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 331 447 3.0E-17
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 341 442 3.0E-17
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 331 447 3.0E-17
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 331 447 3.0E-17
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 330 442 3.0E-17
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 331 447 3.0E-17
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 341 443 3.0E-17
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 334 443 3.0E-17
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 331 443 3.0E-17
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 334 443 3.0E-17
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 334 443 3.0E-17
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 341 442 3.0E-17
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 303 442 3.0E-17
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 341 451 3.0E-17
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 341 443 3.0E-17
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 303 442 3.0E-17
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 331 443 3.0E-17
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 334 442 3.0E-17
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 341 442 4.0E-17
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 341 443 4.0E-17
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 337 443 4.0E-17
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 341 443 4.0E-17
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 341 443 4.0E-17
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 337 443 4.0E-17
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 341 443 4.0E-17
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 334 443 4.0E-17
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 334 481 4.0E-17
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 334 443 4.0E-17
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 341 443 4.0E-17
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 341 442 4.0E-17
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 330 443 4.0E-17
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 443 4.0E-17
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 443 4.0E-17
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 337 443 4.0E-17
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 313 442 4.0E-17
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 334 450 4.0E-17
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 334 443 4.0E-17
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 341 481 4.0E-17
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 339 443 4.0E-17
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 443 4.0E-17
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 433 4.0E-17
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 336 442 4.0E-17
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 340 443 4.0E-17
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 445 4.0E-17
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 337 443 4.0E-17
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 334 456 4.0E-17
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 325 444 4.0E-17
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 331 447 4.0E-17
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 337 444 4.0E-17
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 341 434 4.0E-17
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 328 445 4.0E-17
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 330 442 4.0E-17
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 339 443 4.0E-17
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 331 440 4.0E-17
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 341 443 4.0E-17
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 341 445 4.0E-17
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 341 443 4.0E-17
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 315 442 4.0E-17
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 341 443 4.0E-17
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 331 447 4.0E-17
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 334 443 5.0E-17
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 341 443 5.0E-17
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 442 5.0E-17
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 341 443 5.0E-17
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 275 443 5.0E-17
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 341 442 5.0E-17
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 341 443 5.0E-17
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 341 443 5.0E-17
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 341 451 5.0E-17
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 341 443 5.0E-17
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 334 443 5.0E-17
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 341 443 5.0E-17
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 334 443 5.0E-17
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 334 443 5.0E-17
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 331 442 5.0E-17
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 313 442 5.0E-17
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 334 435 5.0E-17
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 327 445 5.0E-17
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 341 451 5.0E-17
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 341 445 5.0E-17
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 341 443 5.0E-17
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 341 443 5.0E-17
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 334 442 5.0E-17
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 340 443 5.0E-17
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 334 443 5.0E-17
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 339 443 5.0E-17
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 337 481 5.0E-17
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 341 443 5.0E-17
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 341 484 5.0E-17
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 341 445 5.0E-17
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 341 443 5.0E-17
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 339 443 5.0E-17
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 341 445 5.0E-17
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 331 443 5.0E-17
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 334 481 5.0E-17
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 341 443 5.0E-17
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 335 443 6.0E-17
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 334 443 6.0E-17
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 341 442 6.0E-17
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 334 434 6.0E-17
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 334 434 6.0E-17
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 341 443 6.0E-17
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 341 443 6.0E-17
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 341 443 6.0E-17
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 334 443 6.0E-17
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 341 443 6.0E-17
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 337 443 6.0E-17
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 334 443 6.0E-17
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 340 443 6.0E-17
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 340 443 6.0E-17
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 341 442 6.0E-17
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 331 443 6.0E-17
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 443 6.0E-17
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 331 442 6.0E-17
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 445 6.0E-17
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 341 443 6.0E-17
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 6.0E-17
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 341 443 6.0E-17
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 327 442 6.0E-17
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 331 443 6.0E-17
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 442 6.0E-17
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 331 442 6.0E-17
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 337 443 6.0E-17
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 332 464 6.0E-17
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 340 443 6.0E-17
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 340 443 6.0E-17
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 331 447 6.0E-17
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 340 443 6.0E-17
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 331 443 6.0E-17
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 315 442 6.0E-17
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 337 481 6.0E-17
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 331 450 6.0E-17
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 328 445 6.0E-17
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 315 442 6.0E-17
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 331 443 6.0E-17
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 341 452 6.0E-17
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 331 447 6.0E-17
sp|P98182|ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens GN=ZNF200 PE=2 SV=2 329 433 6.0E-17
sp|Q92664|TF3A_HUMAN Transcription factor IIIA OS=Homo sapiens GN=GTF3A PE=1 SV=3 321 455 6.0E-17
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 341 442 7.0E-17
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 341 443 7.0E-17
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 297 443 7.0E-17
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 341 443 7.0E-17
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 334 443 7.0E-17
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 341 443 7.0E-17
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 7.0E-17
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 341 442 7.0E-17
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 334 443 7.0E-17
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 341 443 7.0E-17
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 443 7.0E-17
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 341 443 7.0E-17
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 341 443 7.0E-17
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 341 443 7.0E-17
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 335 484 7.0E-17
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 341 494 7.0E-17
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 341 434 7.0E-17
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 341 443 7.0E-17
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 341 442 7.0E-17
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 335 484 7.0E-17
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 443 7.0E-17
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 341 442 7.0E-17
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 322 443 7.0E-17
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 341 434 7.0E-17
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 341 443 7.0E-17
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 341 442 7.0E-17
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 341 444 7.0E-17
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 327 443 7.0E-17
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 331 447 7.0E-17
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 341 449 7.0E-17
sp|Q91924|SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis GN=snai2 PE=1 SV=1 328 445 7.0E-17
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 443 7.0E-17
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 341 443 8.0E-17
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 313 442 8.0E-17
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 341 443 8.0E-17
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 341 451 8.0E-17
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 337 443 8.0E-17
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 313 422 8.0E-17
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 341 443 8.0E-17
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 442 8.0E-17
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 325 443 8.0E-17
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 290 445 8.0E-17
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 341 442 8.0E-17
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 341 442 8.0E-17
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 341 442 8.0E-17
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 341 442 8.0E-17
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 341 443 8.0E-17
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 8.0E-17
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 341 434 8.0E-17
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 341 434 8.0E-17
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 341 443 8.0E-17
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 337 444 8.0E-17
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 341 443 8.0E-17
sp|Q8ST83|PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster GN=pho PE=1 SV=2 332 442 8.0E-17
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 341 442 8.0E-17
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 328 442 8.0E-17
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 341 451 8.0E-17
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 341 449 8.0E-17
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 334 443 9.0E-17
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 341 443 9.0E-17
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 341 443 9.0E-17
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 313 443 9.0E-17
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 341 442 9.0E-17
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 341 442 9.0E-17
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 341 443 9.0E-17
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 341 443 9.0E-17
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 341 434 9.0E-17
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 305 443 9.0E-17
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 340 443 9.0E-17
sp|Q9VH70|TOPI_DROME Testis-specific zinc finger protein topi OS=Drosophila melanogaster GN=topi PE=1 SV=1 332 443 9.0E-17
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 328 445 9.0E-17
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 334 443 9.0E-17
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 328 442 9.0E-17
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 336 448 9.0E-17
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 325 449 9.0E-17
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 331 442 9.0E-17
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 331 443 9.0E-17
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 341 443 1.0E-16
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 341 443 1.0E-16
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 345 443 1.0E-16
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 345 443 1.0E-16
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 341 443 1.0E-16
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 325 443 1.0E-16
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 341 481 1.0E-16
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 341 481 1.0E-16
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 341 443 1.0E-16
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 341 443 1.0E-16
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 334 443 1.0E-16
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 341 443 1.0E-16
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 319 443 1.0E-16
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 330 445 1.0E-16
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 341 443 1.0E-16
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 341 492 1.0E-16
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 1.0E-16
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 341 445 1.0E-16
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 341 442 1.0E-16
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 341 443 1.0E-16
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 334 443 1.0E-16
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 331 443 1.0E-16
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 341 445 1.0E-16
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 334 450 1.0E-16
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 341 443 1.0E-16
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 334 450 1.0E-16
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 334 450 1.0E-16
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 443 1.0E-16
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 442 1.0E-16
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 341 442 1.0E-16
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 1.0E-16
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 334 450 1.0E-16
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 334 450 1.0E-16
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 341 453 1.0E-16
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 331 445 1.0E-16
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 443 1.0E-16
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 341 443 1.0E-16
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 341 443 1.0E-16
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 1.0E-16
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 341 443 1.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 340 444 1.0E-16
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 341 443 1.0E-16
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 341 443 1.0E-16
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 331 443 1.0E-16
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 341 443 1.0E-16
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 1.0E-16
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 443 1.0E-16
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 340 452 1.0E-16
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 341 443 1.0E-16
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 341 442 1.0E-16
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 341 443 1.0E-16
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 336 443 1.0E-16
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 1.0E-16
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 443 1.0E-16
sp|P18745|ZO22_XENLA Oocyte zinc finger protein XlCOF22 OS=Xenopus laevis PE=3 SV=1 341 443 1.0E-16
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 442 1.0E-16
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 341 443 1.0E-16
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 334 442 1.0E-16
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 341 443 1.0E-16
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 341 443 1.0E-16
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 443 1.0E-16
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 341 433 1.0E-16
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 341 444 1.0E-16
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 332 443 1.0E-16
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 331 456 1.0E-16
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 1.0E-16
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 341 445 1.0E-16
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 341 444 1.0E-16
sp|O08954|SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus GN=Snai2 PE=2 SV=2 341 445 1.0E-16
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 320 442 1.0E-16
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 321 449 1.0E-16
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 1.0E-16
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 303 443 1.0E-16
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 331 447 1.0E-16
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 341 442 1.0E-16
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 341 433 1.0E-16
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 341 452 1.0E-16
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 289 451 1.0E-16
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 330 447 1.0E-16
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 341 443 1.0E-16
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 337 443 1.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 334 443 1.0E-16
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 341 443 1.0E-16
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 341 443 2.0E-16
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 341 443 2.0E-16
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 341 443 2.0E-16
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 337 442 2.0E-16
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 341 443 2.0E-16
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 341 442 2.0E-16
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 443 2.0E-16
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 330 443 2.0E-16
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 341 442 2.0E-16
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 341 449 2.0E-16
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 341 443 2.0E-16
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 337 442 2.0E-16
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 337 442 2.0E-16
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 341 445 2.0E-16
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 334 443 2.0E-16
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 341 452 2.0E-16
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 2.0E-16
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 441 2.0E-16
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 334 450 2.0E-16
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 341 450 2.0E-16
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 336 443 2.0E-16
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 334 443 2.0E-16
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 313 443 2.0E-16
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 341 443 2.0E-16
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 341 449 2.0E-16
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 331 443 2.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 340 442 2.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 341 443 2.0E-16
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 337 443 2.0E-16
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 330 433 2.0E-16
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 331 434 2.0E-16
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 341 443 2.0E-16
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 336 443 2.0E-16
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 331 433 2.0E-16
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 334 443 2.0E-16
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 337 451 2.0E-16
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 341 443 2.0E-16
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 341 442 2.0E-16
sp|P18745|ZO22_XENLA Oocyte zinc finger protein XlCOF22 OS=Xenopus laevis PE=3 SV=1 341 443 2.0E-16
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 329 442 2.0E-16
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 334 443 2.0E-16
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 341 443 2.0E-16
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 334 443 2.0E-16
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 341 481 2.0E-16
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 341 481 2.0E-16
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 341 481 2.0E-16
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 336 443 2.0E-16
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 331 443 2.0E-16
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 275 443 2.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 337 443 2.0E-16
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 341 443 2.0E-16
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 341 442 2.0E-16
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 341 423 2.0E-16
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 341 444 2.0E-16
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 324 420 2.0E-16
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 341 447 2.0E-16
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 331 442 2.0E-16
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 337 443 2.0E-16
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 331 443 2.0E-16
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 341 443 2.0E-16
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 324 420 2.0E-16
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 337 443 2.0E-16
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 242 443 2.0E-16
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 341 442 2.0E-16
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 331 442 2.0E-16
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 2.0E-16
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 341 443 2.0E-16
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 443 2.0E-16
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 341 442 2.0E-16
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 328 418 2.0E-16
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 337 443 2.0E-16
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 341 443 2.0E-16
sp|Q59KL6|TF3A_CANAL Transcription factor IIIA OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PZF1 PE=2 SV=1 332 451 2.0E-16
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 327 449 2.0E-16
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 334 420 3.0E-16
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 320 443 3.0E-16
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 337 443 3.0E-16
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 340 443 3.0E-16
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 341 442 3.0E-16
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 331 443 3.0E-16
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 340 444 3.0E-16
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 341 443 3.0E-16
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 341 443 3.0E-16
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 341 443 3.0E-16
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 341 443 3.0E-16
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 334 450 3.0E-16
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 331 443 3.0E-16
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 341 435 3.0E-16
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 337 443 3.0E-16
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 341 443 3.0E-16
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 334 450 3.0E-16
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 341 443 3.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 341 443 3.0E-16
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 341 443 3.0E-16
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 341 449 3.0E-16
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 336 443 3.0E-16
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 341 443 3.0E-16
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 334 442 3.0E-16
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 328 442 3.0E-16
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 442 3.0E-16
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 341 434 3.0E-16
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 341 443 3.0E-16
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 341 443 3.0E-16
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 330 443 3.0E-16
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 336 443 3.0E-16
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 341 443 3.0E-16
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 334 443 3.0E-16
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 337 442 4.0E-16
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 340 443 4.0E-16
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 334 443 4.0E-16
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 341 443 4.0E-16
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 341 443 4.0E-16
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 435 4.0E-16
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 337 443 4.0E-16
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 346 442 4.0E-16
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 334 445 4.0E-16
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 341 466 4.0E-16
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 341 443 4.0E-16
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 341 443 4.0E-16
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 444 4.0E-16
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 341 443 4.0E-16
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 341 443 4.0E-16
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 248 443 4.0E-16
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 341 443 4.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 341 442 4.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 331 443 4.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 341 443 4.0E-16
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 442 4.0E-16
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 337 442 4.0E-16
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 334 442 4.0E-16
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 339 443 4.0E-16
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 341 443 4.0E-16
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 325 445 4.0E-16
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 337 443 4.0E-16
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 341 443 4.0E-16
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 341 442 4.0E-16
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 341 443 4.0E-16
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 442 4.0E-16
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 341 443 4.0E-16
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 334 442 4.0E-16
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 334 444 4.0E-16
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 341 446 4.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 337 443 4.0E-16
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 337 443 4.0E-16
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 337 443 4.0E-16
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 443 5.0E-16
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 341 435 5.0E-16
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 341 443 5.0E-16
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 341 443 5.0E-16
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 341 442 5.0E-16
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 340 444 5.0E-16
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 341 443 5.0E-16
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 443 5.0E-16
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 443 5.0E-16
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 336 443 5.0E-16
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 339 443 5.0E-16
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 341 443 5.0E-16
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 341 481 5.0E-16
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 341 443 5.0E-16
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 433 5.0E-16
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 337 443 5.0E-16
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 341 443 5.0E-16
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 341 494 5.0E-16
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 341 443 5.0E-16
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 341 445 5.0E-16
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 341 443 5.0E-16
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 339 445 5.0E-16
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 334 443 5.0E-16
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 331 443 5.0E-16
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 337 443 5.0E-16
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 341 424 6.0E-16
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 341 443 6.0E-16
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 331 443 6.0E-16
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 341 443 6.0E-16
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 341 443 6.0E-16
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 340 443 6.0E-16
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 341 443 6.0E-16
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 341 443 6.0E-16
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 341 443 6.0E-16
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 341 443 6.0E-16
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 341 443 6.0E-16
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 341 443 6.0E-16
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 341 443 6.0E-16
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 443 6.0E-16
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 337 443 6.0E-16
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 334 443 6.0E-16
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 442 6.0E-16
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 341 443 6.0E-16
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 339 445 6.0E-16
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 341 443 6.0E-16
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 341 418 7.0E-16
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 340 444 7.0E-16
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 341 443 7.0E-16
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 341 443 7.0E-16
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 341 443 7.0E-16
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 341 443 7.0E-16
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 341 443 7.0E-16
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 341 443 7.0E-16
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 341 443 7.0E-16
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 341 481 7.0E-16
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 330 443 7.0E-16
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 334 443 7.0E-16
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 331 442 7.0E-16
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 341 443 7.0E-16
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 294 443 7.0E-16
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 297 443 7.0E-16
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 327 443 7.0E-16
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 331 443 7.0E-16
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 331 443 7.0E-16
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 330 443 7.0E-16
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 340 451 8.0E-16
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 341 443 8.0E-16
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 341 443 8.0E-16
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 336 443 8.0E-16
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 341 481 8.0E-16
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 334 424 8.0E-16
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 341 453 8.0E-16
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 341 453 8.0E-16
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 327 451 8.0E-16
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 286 442 8.0E-16
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 337 443 8.0E-16
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 341 443 8.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 337 443 8.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 341 442 8.0E-16
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 341 443 8.0E-16
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 341 450 8.0E-16
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 341 443 9.0E-16
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 341 443 9.0E-16
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 337 443 9.0E-16
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 341 443 9.0E-16
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 341 442 9.0E-16
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 9.0E-16
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 341 481 9.0E-16
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 443 9.0E-16
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 341 443 9.0E-16
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 341 443 9.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 334 443 9.0E-16
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 339 445 9.0E-16
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 341 443 1.0E-15
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 337 443 1.0E-15
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 444 1.0E-15
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 331 443 1.0E-15
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 334 421 1.0E-15
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 337 443 1.0E-15
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 341 443 1.0E-15
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 331 416 1.0E-15
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 341 443 1.0E-15
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 331 434 1.0E-15
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 341 443 1.0E-15
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 341 481 1.0E-15
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 331 434 1.0E-15
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 331 443 1.0E-15
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 334 443 1.0E-15
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 1.0E-15
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 1.0E-15
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 1.0E-15
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 359 442 1.0E-15
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 329 442 1.0E-15
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 443 1.0E-15
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 331 443 1.0E-15
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 337 443 1.0E-15
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 341 429 1.0E-15
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 341 445 1.0E-15
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 341 443 1.0E-15
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 297 443 1.0E-15
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 353 443 1.0E-15
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 341 442 1.0E-15
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 339 443 1.0E-15
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 337 443 1.0E-15
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 443 1.0E-15
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 449 1.0E-15
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 336 428 1.0E-15
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 341 442 1.0E-15
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 443 1.0E-15
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 330 443 1.0E-15
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 266 443 1.0E-15
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 341 442 1.0E-15
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 341 435 1.0E-15
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 442 1.0E-15
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 334 443 1.0E-15
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 340 526 1.0E-15
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 341 443 1.0E-15
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 327 443 1.0E-15
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 443 1.0E-15
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 341 451 1.0E-15
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 334 422 2.0E-15
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 341 443 2.0E-15
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 334 422 2.0E-15
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 341 442 2.0E-15
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 337 443 2.0E-15
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 341 443 2.0E-15
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 341 444 2.0E-15
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 341 443 2.0E-15
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 341 443 2.0E-15
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 337 443 2.0E-15
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 334 443 2.0E-15
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 336 443 2.0E-15
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 341 443 2.0E-15
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 337 443 2.0E-15
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 271 443 2.0E-15
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 305 443 2.0E-15
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 341 443 2.0E-15
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 319 443 2.0E-15
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 341 418 2.0E-15
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 341 418 2.0E-15
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 334 443 2.0E-15
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 2.0E-15
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 341 443 2.0E-15
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 2.0E-15
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 336 444 2.0E-15
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 341 444 2.0E-15
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 341 443 2.0E-15
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 442 2.0E-15
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 433 2.0E-15
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 339 418 2.0E-15
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 331 442 2.0E-15
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 341 443 2.0E-15
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 356 443 2.0E-15
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 339 443 2.0E-15
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 313 442 2.0E-15
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 341 445 2.0E-15
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 341 444 2.0E-15
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 341 443 2.0E-15
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 341 444 2.0E-15
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 443 2.0E-15
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 341 443 2.0E-15
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 313 442 2.0E-15
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 341 443 2.0E-15
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 2.0E-15
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 341 443 2.0E-15
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 337 434 2.0E-15
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 341 443 2.0E-15
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 445 2.0E-15
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 337 443 2.0E-15
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 336 443 2.0E-15
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 337 443 2.0E-15
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 2.0E-15
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 341 443 2.0E-15
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 442 2.0E-15
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 341 443 2.0E-15
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 331 443 2.0E-15
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 341 434 2.0E-15
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 291 442 2.0E-15
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 341 443 2.0E-15
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 341 433 2.0E-15
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 291 442 2.0E-15
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 341 443 2.0E-15
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 341 443 2.0E-15
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 331 444 2.0E-15
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 443 2.0E-15
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 337 443 2.0E-15
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 341 444 2.0E-15
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 341 444 2.0E-15
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 341 443 2.0E-15
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 331 443 2.0E-15
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 341 442 3.0E-15
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 331 421 3.0E-15
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 341 444 3.0E-15
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 337 443 3.0E-15
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 341 443 3.0E-15
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 231 442 3.0E-15
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 329 416 3.0E-15
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 321 451 3.0E-15
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 315 443 3.0E-15
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 442 3.0E-15
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 341 444 3.0E-15
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 341 444 3.0E-15
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 331 442 3.0E-15
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 339 443 3.0E-15
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 341 443 3.0E-15
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 422 3.0E-15
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 337 447 3.0E-15
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 341 443 3.0E-15
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 334 443 3.0E-15
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 337 433 3.0E-15
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 313 442 3.0E-15
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 334 442 3.0E-15
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 443 3.0E-15
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 341 443 3.0E-15
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 443 3.0E-15
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 290 443 3.0E-15
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 331 443 3.0E-15
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 331 443 3.0E-15
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 341 453 3.0E-15
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 341 435 3.0E-15
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 443 3.0E-15
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 337 443 3.0E-15
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 447 3.0E-15
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 331 443 3.0E-15
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 341 442 3.0E-15
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 3.0E-15
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 341 442 3.0E-15
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 341 433 3.0E-15
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 341 444 3.0E-15
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 341 493 3.0E-15
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 341 443 3.0E-15
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 341 443 3.0E-15
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 341 443 4.0E-15
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 341 443 4.0E-15
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 341 443 4.0E-15
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 341 420 4.0E-15
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 341 416 4.0E-15
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 341 443 4.0E-15
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 334 417 4.0E-15
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 341 421 4.0E-15
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 339 444 4.0E-15
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 341 443 4.0E-15
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 341 443 4.0E-15
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 331 443 4.0E-15
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 341 444 4.0E-15
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 334 416 4.0E-15
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 339 443 4.0E-15
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 341 443 4.0E-15
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 341 481 4.0E-15
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 340 434 4.0E-15
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 341 443 4.0E-15
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 341 457 4.0E-15
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 341 443 4.0E-15
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 334 418 4.0E-15
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 337 443 4.0E-15
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 337 443 4.0E-15
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 337 443 4.0E-15
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 341 443 4.0E-15
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 337 450 4.0E-15
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 341 443 4.0E-15
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 445 4.0E-15
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 341 442 4.0E-15
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 341 443 4.0E-15
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 336 443 4.0E-15
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 340 443 5.0E-15
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 340 451 5.0E-15
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 337 420 5.0E-15
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 435 5.0E-15
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 334 443 5.0E-15
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 443 5.0E-15
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 337 443 5.0E-15
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 5.0E-15
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 5.0E-15
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 337 442 5.0E-15
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 341 447 5.0E-15
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 324 442 5.0E-15
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 340 442 5.0E-15
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 341 443 5.0E-15
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 331 443 5.0E-15
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 341 443 5.0E-15
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 341 451 5.0E-15
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 341 443 5.0E-15
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 341 443 5.0E-15
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 341 442 5.0E-15
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 337 444 5.0E-15
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 341 443 5.0E-15
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 341 442 6.0E-15
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 341 443 6.0E-15
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 341 451 6.0E-15
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 339 443 6.0E-15
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 334 443 6.0E-15
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 331 434 6.0E-15
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 331 443 6.0E-15
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 334 445 6.0E-15
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 6.0E-15
sp|P18745|ZO22_XENLA Oocyte zinc finger protein XlCOF22 OS=Xenopus laevis PE=3 SV=1 341 447 6.0E-15
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 442 6.0E-15
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 341 451 6.0E-15
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 341 442 6.0E-15
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 341 443 6.0E-15
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 341 442 6.0E-15
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 341 451 6.0E-15
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 341 443 6.0E-15
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 341 443 6.0E-15
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 334 442 6.0E-15
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 6.0E-15
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 6.0E-15
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 341 443 6.0E-15
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 341 443 6.0E-15
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 341 443 6.0E-15
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 443 6.0E-15
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 324 442 7.0E-15
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 341 443 7.0E-15
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 341 443 7.0E-15
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 341 449 7.0E-15
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 341 443 7.0E-15
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 7.0E-15
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 443 7.0E-15
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 442 7.0E-15
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 341 443 7.0E-15
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 337 443 7.0E-15
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 334 443 7.0E-15
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 341 443 7.0E-15
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 341 442 7.0E-15
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 334 442 7.0E-15
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 340 443 7.0E-15
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 336 443 8.0E-15
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 341 443 8.0E-15
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 341 443 8.0E-15
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 341 443 8.0E-15
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 341 443 8.0E-15
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 270 443 8.0E-15
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 341 443 8.0E-15
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 325 458 8.0E-15
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 341 449 8.0E-15
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 341 443 8.0E-15
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 336 444 8.0E-15
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 340 443 8.0E-15
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 341 433 8.0E-15
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 443 8.0E-15
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 341 443 8.0E-15
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 337 443 8.0E-15
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 334 443 8.0E-15
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 337 443 8.0E-15
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 341 451 9.0E-15
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 341 443 9.0E-15
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 331 443 9.0E-15
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 443 9.0E-15
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 442 9.0E-15
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 443 9.0E-15
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 341 442 9.0E-15
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 341 443 9.0E-15
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 334 443 9.0E-15
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 341 421 9.0E-15
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 341 421 9.0E-15
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 341 443 9.0E-15
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 341 443 9.0E-15
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 341 420 1.0E-14
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 341 420 1.0E-14
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 339 416 1.0E-14
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 335 466 1.0E-14
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 341 443 1.0E-14
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 341 443 1.0E-14
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 341 443 1.0E-14
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 337 416 1.0E-14
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 422 1.0E-14
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 444 1.0E-14
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 442 1.0E-14
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 339 443 1.0E-14
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 341 443 1.0E-14
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 340 451 1.0E-14
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 334 443 1.0E-14
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 341 442 1.0E-14
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 481 1.0E-14
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 337 442 1.0E-14
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 341 442 1.0E-14
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 331 445 1.0E-14
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 331 445 1.0E-14
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 341 443 1.0E-14
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 341 443 1.0E-14
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 341 449 1.0E-14
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 341 443 1.0E-14
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 1.0E-14
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 325 443 1.0E-14
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 324 442 1.0E-14
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 331 443 1.0E-14
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 341 443 1.0E-14
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 322 443 1.0E-14
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 337 443 1.0E-14
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 341 434 1.0E-14
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 341 443 1.0E-14
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 322 443 1.0E-14
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 337 443 1.0E-14
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 341 445 1.0E-14
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 341 452 1.0E-14
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 341 443 1.0E-14
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 341 443 1.0E-14
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 442 1.0E-14
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 337 481 1.0E-14
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 341 428 1.0E-14
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 442 1.0E-14
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 341 443 1.0E-14
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 310 442 1.0E-14
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 341 443 1.0E-14
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 336 485 1.0E-14
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 331 443 1.0E-14
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 327 442 1.0E-14
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 341 421 1.0E-14
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 293 434 1.0E-14
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 334 442 1.0E-14
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 335 433 1.0E-14
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 341 445 1.0E-14
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 341 443 1.0E-14
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 341 445 1.0E-14
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 1.0E-14
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 341 443 1.0E-14
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 341 445 1.0E-14
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 329 442 2.0E-14
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 329 442 2.0E-14
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 337 443 2.0E-14
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 337 416 2.0E-14
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 337 443 2.0E-14
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 335 445 2.0E-14
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 325 418 2.0E-14
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 331 443 2.0E-14
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 329 442 2.0E-14
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 327 443 2.0E-14
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 337 416 2.0E-14
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 340 443 2.0E-14
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 345 443 2.0E-14
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 337 416 2.0E-14
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 327 443 2.0E-14
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 331 481 2.0E-14
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 442 2.0E-14
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 341 443 2.0E-14
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 331 481 2.0E-14
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 334 422 2.0E-14
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 333 442 2.0E-14
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 2.0E-14
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 341 443 2.0E-14
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 341 443 2.0E-14
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 341 443 2.0E-14
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 339 466 2.0E-14
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 419 2.0E-14
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 341 481 2.0E-14
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 288 444 2.0E-14
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 443 2.0E-14
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 341 445 2.0E-14
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 341 443 2.0E-14
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 337 443 2.0E-14
sp|Q9H9D4|ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens GN=ZNF408 PE=1 SV=1 339 442 2.0E-14
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 341 443 2.0E-14
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 341 443 2.0E-14
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 443 2.0E-14
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 334 443 2.0E-14
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 2.0E-14
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 341 433 2.0E-14
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 341 442 2.0E-14
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 434 2.0E-14
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 337 481 2.0E-14
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 341 443 2.0E-14
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 337 481 2.0E-14
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 331 443 2.0E-14
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 339 457 2.0E-14
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 341 443 2.0E-14
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 339 451 2.0E-14
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 337 442 2.0E-14
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 341 443 2.0E-14
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 341 445 2.0E-14
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 311 443 2.0E-14
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 341 444 2.0E-14
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 341 444 2.0E-14
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 331 443 2.0E-14
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 341 421 2.0E-14
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 336 443 2.0E-14
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 337 443 2.0E-14
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 362 443 3.0E-14
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 337 443 3.0E-14
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 337 443 3.0E-14
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 337 443 3.0E-14
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 341 428 3.0E-14
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 347 443 3.0E-14
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 341 443 3.0E-14
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 341 416 3.0E-14
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 334 442 3.0E-14
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 331 443 3.0E-14
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 331 443 3.0E-14
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 341 443 3.0E-14
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 443 3.0E-14
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 442 3.0E-14
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 349 443 3.0E-14
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 331 443 3.0E-14
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 341 442 3.0E-14
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 341 443 3.0E-14
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 341 425 3.0E-14
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 340 443 3.0E-14
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 340 443 3.0E-14
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 341 443 3.0E-14
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 341 443 3.0E-14
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 341 443 3.0E-14
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 337 445 3.0E-14
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 340 442 3.0E-14
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 341 442 3.0E-14
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 337 443 3.0E-14
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 322 443 3.0E-14
sp|Q8ST83|PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster GN=pho PE=1 SV=2 335 416 3.0E-14
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 341 443 3.0E-14
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 341 443 3.0E-14
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 331 443 3.0E-14
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 341 443 3.0E-14
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 341 443 3.0E-14
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 341 444 3.0E-14
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 337 443 3.0E-14
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 443 3.0E-14
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 337 443 3.0E-14
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 444 4.0E-14
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 360 443 4.0E-14
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 341 443 4.0E-14
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 341 443 4.0E-14
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 341 416 4.0E-14
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 443 4.0E-14
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 442 4.0E-14
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 341 442 4.0E-14
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 341 443 4.0E-14
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 332 433 4.0E-14
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 337 443 4.0E-14
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 341 481 4.0E-14
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 341 443 4.0E-14
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 341 443 4.0E-14
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 443 4.0E-14
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 341 443 4.0E-14
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 443 4.0E-14
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 341 416 4.0E-14
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 337 443 4.0E-14
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 341 443 4.0E-14
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 443 4.0E-14
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 337 443 4.0E-14
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 337 443 4.0E-14
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 341 443 4.0E-14
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 331 442 4.0E-14
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 443 4.0E-14
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 341 443 4.0E-14
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 341 442 4.0E-14
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 311 443 4.0E-14
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 341 419 5.0E-14
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 341 443 5.0E-14
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 330 423 5.0E-14
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 341 442 5.0E-14
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 335 443 5.0E-14
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 341 444 5.0E-14
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 341 481 5.0E-14
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 341 449 5.0E-14
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 443 5.0E-14
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 341 443 5.0E-14
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 341 443 5.0E-14
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 442 5.0E-14
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 341 450 5.0E-14
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 341 442 5.0E-14
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 341 443 5.0E-14
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 341 443 5.0E-14
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 337 443 5.0E-14
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 351 445 5.0E-14
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 342 443 5.0E-14
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 336 443 5.0E-14
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 336 443 5.0E-14
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 334 481 5.0E-14
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 336 443 5.0E-14
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 325 443 5.0E-14
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 337 443 5.0E-14
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 5.0E-14
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 337 442 6.0E-14
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 361 445 6.0E-14
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 337 442 6.0E-14
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 341 443 6.0E-14
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 341 433 6.0E-14
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 337 452 6.0E-14
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 337 443 6.0E-14
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 341 420 6.0E-14
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 331 428 6.0E-14
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 341 416 6.0E-14
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 340 443 6.0E-14
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 443 6.0E-14
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 442 6.0E-14
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 341 445 6.0E-14
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 341 443 6.0E-14
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 341 443 6.0E-14
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 331 443 7.0E-14
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 339 416 7.0E-14
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 341 443 7.0E-14
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 331 443 7.0E-14
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 442 7.0E-14
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 425 7.0E-14
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 328 443 7.0E-14
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 297 443 7.0E-14
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 343 443 7.0E-14
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 341 443 7.0E-14
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 341 442 7.0E-14
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 341 481 7.0E-14
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 341 443 7.0E-14
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 341 443 7.0E-14
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 341 443 7.0E-14
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 341 443 8.0E-14
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 336 443 8.0E-14
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 337 442 8.0E-14
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 345 443 8.0E-14
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 443 8.0E-14
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 341 443 8.0E-14
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 341 443 8.0E-14
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 328 416 8.0E-14
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 422 8.0E-14
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 341 443 8.0E-14
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 341 481 8.0E-14
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 337 443 8.0E-14
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 339 465 8.0E-14
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 341 443 8.0E-14
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 334 443 9.0E-14
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 337 416 9.0E-14
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 335 445 9.0E-14
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 341 416 9.0E-14
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 336 433 9.0E-14
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 325 422 9.0E-14
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 341 481 9.0E-14
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 442 9.0E-14
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 341 416 9.0E-14
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 332 443 9.0E-14
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 341 443 9.0E-14
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 341 443 1.0E-13
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 341 443 1.0E-13
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 352 442 1.0E-13
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 341 416 1.0E-13
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 341 443 1.0E-13
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 341 433 1.0E-13
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 341 444 1.0E-13
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 443 1.0E-13
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 333 442 1.0E-13
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 330 442 1.0E-13
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 336 421 1.0E-13
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 443 1.0E-13
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 341 442 1.0E-13
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 341 443 1.0E-13
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 341 443 1.0E-13
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 341 442 1.0E-13
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 341 443 1.0E-13
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 341 443 1.0E-13
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 341 421 1.0E-13
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 334 443 1.0E-13
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 328 416 1.0E-13
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 313 442 1.0E-13
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 359 443 1.0E-13
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 337 444 1.0E-13
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 337 444 1.0E-13
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 337 442 1.0E-13
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 443 1.0E-13
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 334 450 1.0E-13
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 341 443 1.0E-13
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 341 447 1.0E-13
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 337 422 1.0E-13
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 341 447 1.0E-13
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 322 443 1.0E-13
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 334 443 1.0E-13
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 305 443 1.0E-13
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 341 450 1.0E-13
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 341 442 1.0E-13
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 339 442 1.0E-13
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 341 421 1.0E-13
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 331 418 1.0E-13
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 341 433 1.0E-13
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 341 442 1.0E-13
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 337 444 1.0E-13
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 336 442 2.0E-13
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 341 416 2.0E-13
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 339 422 2.0E-13
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 339 443 2.0E-13
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 341 443 2.0E-13
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 341 419 2.0E-13
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 341 443 2.0E-13
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 334 443 2.0E-13
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 341 443 2.0E-13
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 341 443 2.0E-13
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 341 443 2.0E-13
sp|Q5U4E2|REPI1_MOUSE Replication initiator 1 OS=Mus musculus GN=Repin1 PE=1 SV=1 341 444 2.0E-13
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 341 443 2.0E-13
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 337 442 2.0E-13
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 341 443 2.0E-13
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 341 443 2.0E-13
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 341 455 2.0E-13
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 341 418 2.0E-13
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 331 443 2.0E-13
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 341 443 2.0E-13
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 2.0E-13
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 319 444 2.0E-13
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 341 481 2.0E-13
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 341 422 2.0E-13
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 360 442 2.0E-13
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 341 443 2.0E-13
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 341 447 2.0E-13
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 341 443 2.0E-13
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 331 443 2.0E-13
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 339 442 2.0E-13
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 341 435 2.0E-13
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 337 416 2.0E-13
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 341 443 2.0E-13
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 341 443 2.0E-13
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 334 442 2.0E-13
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 339 442 2.0E-13
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 341 443 3.0E-13
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 341 443 3.0E-13
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 341 443 3.0E-13
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 341 442 3.0E-13
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 330 442 3.0E-13
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 334 443 3.0E-13
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 330 442 3.0E-13
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 334 443 3.0E-13
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 341 443 3.0E-13
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 341 443 3.0E-13
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 362 473 3.0E-13
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 321 443 3.0E-13
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 337 418 3.0E-13
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 341 434 3.0E-13
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 337 442 3.0E-13
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 315 416 3.0E-13
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 341 443 3.0E-13
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 337 443 4.0E-13
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 325 423 4.0E-13
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 331 443 4.0E-13
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 341 442 4.0E-13
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 341 443 4.0E-13
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 341 443 4.0E-13
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 341 443 4.0E-13
sp|Q68H95|REPI1_RAT Replication initiator 1 OS=Rattus norvegicus GN=Repin1 PE=2 SV=1 341 443 4.0E-13
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 336 443 4.0E-13
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 341 420 4.0E-13
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 325 434 4.0E-13
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 336 445 4.0E-13
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 443 4.0E-13
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 341 443 4.0E-13
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 342 442 4.0E-13
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 340 443 4.0E-13
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 337 443 4.0E-13
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 331 443 4.0E-13
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 315 442 4.0E-13
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 443 4.0E-13
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 331 457 4.0E-13
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 4.0E-13
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 362 443 4.0E-13
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 289 443 4.0E-13
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 341 443 4.0E-13
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 447 4.0E-13
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 349 481 4.0E-13
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 337 416 5.0E-13
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 355 443 5.0E-13
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 355 443 5.0E-13
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 324 418 5.0E-13
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 341 416 5.0E-13
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 341 443 5.0E-13
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 337 443 5.0E-13
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 341 443 5.0E-13
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 341 416 5.0E-13
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 341 443 5.0E-13
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 334 416 5.0E-13
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 341 435 5.0E-13
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 331 433 5.0E-13
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 341 443 5.0E-13
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 341 443 5.0E-13
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 341 443 5.0E-13
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 341 442 5.0E-13
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 328 443 5.0E-13
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 369 443 5.0E-13
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 345 442 5.0E-13
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 337 443 5.0E-13
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 334 443 5.0E-13
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 341 443 5.0E-13
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 325 416 6.0E-13
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 339 443 6.0E-13
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 337 443 6.0E-13
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 331 443 6.0E-13
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 443 6.0E-13
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 341 443 6.0E-13
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 443 6.0E-13
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 442 6.0E-13
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 337 443 6.0E-13
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 424 6.0E-13
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 334 442 6.0E-13
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 341 416 6.0E-13
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 341 416 7.0E-13
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 341 416 7.0E-13
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 337 443 7.0E-13
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 341 421 7.0E-13
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 341 433 7.0E-13
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 273 443 7.0E-13
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 362 443 7.0E-13
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 341 422 7.0E-13
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 341 418 7.0E-13
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 341 443 7.0E-13
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 337 442 7.0E-13
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 337 442 7.0E-13
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 331 433 7.0E-13
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 339 443 7.0E-13
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 341 443 7.0E-13
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 341 420 7.0E-13
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 341 420 7.0E-13
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 341 420 7.0E-13
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 322 443 7.0E-13
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 341 445 7.0E-13
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 7.0E-13
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 443 7.0E-13
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 341 443 7.0E-13
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 353 443 8.0E-13
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 341 416 8.0E-13
sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens GN=REPIN1 PE=1 SV=1 334 444 8.0E-13
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 345 443 8.0E-13
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 341 443 8.0E-13
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 341 443 8.0E-13
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 337 443 8.0E-13
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 339 443 8.0E-13
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 341 416 8.0E-13
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 341 417 9.0E-13
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 341 436 9.0E-13
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 341 433 9.0E-13
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 349 443 9.0E-13
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 341 443 9.0E-13
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 341 433 9.0E-13
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 328 443 9.0E-13
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 336 422 9.0E-13
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 345 442 9.0E-13
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 334 442 1.0E-12
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 335 443 1.0E-12
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 341 416 1.0E-12
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 339 443 1.0E-12
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 362 483 1.0E-12
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 321 443 1.0E-12
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 311 443 1.0E-12
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 1.0E-12
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 341 420 1.0E-12
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 341 424 1.0E-12
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 337 443 1.0E-12
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 340 443 1.0E-12
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 341 443 1.0E-12
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 341 416 1.0E-12
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 341 443 1.0E-12
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 327 445 1.0E-12
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 341 443 1.0E-12
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 341 418 1.0E-12
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 341 418 1.0E-12
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 341 418 1.0E-12
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 341 418 1.0E-12
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 337 442 1.0E-12
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 341 418 1.0E-12
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 341 445 1.0E-12
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 331 455 1.0E-12
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 341 445 1.0E-12
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 341 443 1.0E-12
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 1.0E-12
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 442 1.0E-12
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 360 443 1.0E-12
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 341 442 1.0E-12
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 443 1.0E-12
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 345 443 1.0E-12
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 341 443 1.0E-12
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 301 443 1.0E-12
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 341 442 1.0E-12
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 358 443 1.0E-12
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 341 433 1.0E-12
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 341 442 1.0E-12
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 331 443 1.0E-12
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 1.0E-12
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 290 442 2.0E-12
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 341 443 2.0E-12
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 341 443 2.0E-12
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 341 419 2.0E-12
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 341 420 2.0E-12
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 341 443 2.0E-12
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 358 443 2.0E-12
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 341 428 2.0E-12
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 341 418 2.0E-12
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 341 417 2.0E-12
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 341 420 2.0E-12
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 360 442 2.0E-12
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 327 450 2.0E-12
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 341 443 2.0E-12
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 341 443 2.0E-12
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 425 2.0E-12
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 331 443 2.0E-12
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 313 426 2.0E-12
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 433 2.0E-12
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 341 422 2.0E-12
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 334 435 2.0E-12
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 337 416 2.0E-12
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 334 423 2.0E-12
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 341 443 2.0E-12
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 341 443 2.0E-12
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 443 2.0E-12
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 347 443 2.0E-12
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 334 459 2.0E-12
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 341 442 2.0E-12
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 337 442 2.0E-12
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 341 482 2.0E-12
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 341 442 2.0E-12
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 331 443 2.0E-12
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 442 2.0E-12
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 337 443 2.0E-12
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 341 416 2.0E-12
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 341 416 2.0E-12
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 336 443 2.0E-12
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 2.0E-12
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 2.0E-12
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 481 2.0E-12
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 443 2.0E-12
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 337 443 2.0E-12
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 341 443 3.0E-12
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 341 423 3.0E-12
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 341 443 3.0E-12
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 341 416 3.0E-12
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 307 442 3.0E-12
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 341 433 3.0E-12
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 348 443 3.0E-12
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 327 445 3.0E-12
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 3.0E-12
sp|P18728|ZG53_XENLA Gastrula zinc finger protein XlCGF53.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 416 3.0E-12
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 228 443 3.0E-12
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 351 443 3.0E-12
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 341 417 3.0E-12
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 341 422 3.0E-12
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 341 416 3.0E-12
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 337 442 3.0E-12
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 334 443 3.0E-12
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 332 442 3.0E-12
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 341 444 3.0E-12
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 444 3.0E-12
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 341 422 4.0E-12
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 341 443 4.0E-12
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 337 443 4.0E-12
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 362 483 4.0E-12
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 341 416 4.0E-12
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 341 416 4.0E-12
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 341 416 4.0E-12
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 338 443 4.0E-12
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 341 481 4.0E-12
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 325 422 4.0E-12
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 369 443 4.0E-12
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 4.0E-12
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 341 443 4.0E-12
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 341 443 4.0E-12
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 327 418 4.0E-12
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 327 416 4.0E-12
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 305 451 4.0E-12
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 443 4.0E-12
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 341 418 5.0E-12
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 189 443 5.0E-12
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 339 442 5.0E-12
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 353 444 5.0E-12
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 334 443 5.0E-12
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 334 433 5.0E-12
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 330 413 5.0E-12
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 337 418 5.0E-12
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 336 443 5.0E-12
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 356 481 5.0E-12
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 353 444 6.0E-12
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 6.0E-12
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 331 443 6.0E-12
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 331 443 6.0E-12
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 325 443 6.0E-12
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 6.0E-12
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 337 443 6.0E-12
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 341 445 6.0E-12
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 339 443 6.0E-12
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 442 6.0E-12
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 306 442 6.0E-12
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 341 417 6.0E-12
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 341 417 6.0E-12
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 325 424 7.0E-12
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 362 443 7.0E-12
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 331 431 7.0E-12
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 307 449 7.0E-12
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 339 416 7.0E-12
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 325 443 7.0E-12
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 341 442 7.0E-12
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 341 443 7.0E-12
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 341 443 7.0E-12
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 341 443 7.0E-12
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 341 445 7.0E-12
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 341 422 7.0E-12
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 341 417 7.0E-12
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 443 7.0E-12
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 355 443 8.0E-12
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 341 443 8.0E-12
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 341 420 8.0E-12
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 356 443 8.0E-12
sp|O94892|ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens GN=ZNF432 PE=1 SV=1 348 443 8.0E-12
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 341 443 8.0E-12
sp|P18745|ZO22_XENLA Oocyte zinc finger protein XlCOF22 OS=Xenopus laevis PE=3 SV=1 352 434 8.0E-12
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 341 445 8.0E-12
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 341 416 8.0E-12
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 341 419 9.0E-12
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 342 443 9.0E-12
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 331 443 9.0E-12
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 351 443 9.0E-12
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 341 443 9.0E-12
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 341 443 9.0E-12
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 341 443 9.0E-12
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 362 443 1.0E-11
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 331 416 1.0E-11
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 341 417 1.0E-11
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 331 443 1.0E-11
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 341 443 1.0E-11
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 443 1.0E-11
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 361 449 1.0E-11
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 341 422 1.0E-11
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 351 443 1.0E-11
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 341 443 1.0E-11
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 343 443 1.0E-11
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 341 481 1.0E-11
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 369 443 1.0E-11
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 345 434 1.0E-11
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 341 418 1.0E-11
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 339 443 1.0E-11
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 359 442 1.0E-11
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 334 434 1.0E-11
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 334 443 1.0E-11
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 369 489 1.0E-11
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 362 445 1.0E-11
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 331 442 1.0E-11
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 416 1.0E-11
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 330 443 1.0E-11
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 298 443 1.0E-11
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 341 443 1.0E-11
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 341 443 2.0E-11
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 330 416 2.0E-11
sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus GN=REPIN1 PE=2 SV=1 341 444 2.0E-11
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 341 432 2.0E-11
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 341 451 2.0E-11
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 443 2.0E-11
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 343 443 2.0E-11
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 342 443 2.0E-11
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 325 416 2.0E-11
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 360 442 2.0E-11
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 361 443 2.0E-11
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 341 443 2.0E-11
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 341 422 2.0E-11
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 228 443 2.0E-11
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 361 449 2.0E-11
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 360 443 2.0E-11
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 361 443 2.0E-11
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 337 443 2.0E-11
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 337 495 2.0E-11
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 341 433 2.0E-11
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 337 446 2.0E-11
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 337 421 2.0E-11
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 341 434 2.0E-11
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 341 443 2.0E-11
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 341 444 2.0E-11
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 316 443 2.0E-11
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 317 443 2.0E-11
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 340 445 2.0E-11
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 341 443 2.0E-11
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 2.0E-11
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 331 442 3.0E-11
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 337 443 3.0E-11
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 334 443 3.0E-11
sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens GN=REPIN1 PE=1 SV=1 364 445 3.0E-11
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 351 443 3.0E-11
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 341 443 3.0E-11
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 337 497 3.0E-11
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 334 434 3.0E-11
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 341 444 3.0E-11
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 443 3.0E-11
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 326 463 3.0E-11
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 341 442 3.0E-11
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 341 434 3.0E-11
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 341 443 3.0E-11
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 420 3.0E-11
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 331 442 3.0E-11
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 316 444 3.0E-11
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 364 445 3.0E-11
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 316 444 3.0E-11
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 341 420 3.0E-11
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 341 443 3.0E-11
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 334 416 3.0E-11
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 341 449 3.0E-11
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 369 449 4.0E-11
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 341 443 4.0E-11
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 341 481 4.0E-11
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 307 449 4.0E-11
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 343 442 4.0E-11
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 341 416 4.0E-11
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 333 442 4.0E-11
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 345 443 5.0E-11
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 356 442 5.0E-11
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 329 463 5.0E-11
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 369 481 5.0E-11
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 354 443 5.0E-11
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 341 442 5.0E-11
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 341 443 5.0E-11
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 341 416 5.0E-11
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 341 443 5.0E-11
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 341 445 5.0E-11
sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1 369 449 6.0E-11
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 345 442 6.0E-11
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 332 416 6.0E-11
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 337 421 6.0E-11
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 326 463 6.0E-11
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 336 443 6.0E-11
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 341 416 6.0E-11
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 341 416 6.0E-11
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 359 443 7.0E-11
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 332 443 7.0E-11
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 332 416 7.0E-11
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 334 483 7.0E-11
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 360 443 7.0E-11
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 345 443 7.0E-11
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 337 443 7.0E-11
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 311 454 7.0E-11
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 341 416 7.0E-11
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 341 445 7.0E-11
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 355 443 8.0E-11
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 8.0E-11
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 362 444 8.0E-11
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 360 443 8.0E-11
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 360 443 8.0E-11
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 359 445 8.0E-11
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 341 418 8.0E-11
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 337 443 8.0E-11
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 336 425 8.0E-11
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 334 416 9.0E-11
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 341 417 9.0E-11
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 327 461 9.0E-11
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 360 443 9.0E-11
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 339 417 9.0E-11
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 321 442 9.0E-11
sp|Q99MD8|MYNN_MOUSE Myoneurin OS=Mus musculus GN=Mynn PE=2 SV=2 369 449 1.0E-10
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 334 416 1.0E-10
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 341 402 1.0E-10
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 357 443 1.0E-10
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 341 416 1.0E-10
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 335 443 1.0E-10
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 341 417 1.0E-10
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 341 423 1.0E-10
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 339 416 1.0E-10
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 341 443 1.0E-10
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 336 443 1.0E-10
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 341 443 1.0E-10
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 341 443 1.0E-10
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 355 443 1.0E-10
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 337 449 1.0E-10
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 1.0E-10
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 336 443 1.0E-10
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 363 443 1.0E-10
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 337 443 1.0E-10
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 338 443 1.0E-10
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 337 444 1.0E-10
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 332 443 1.0E-10
sp|P98182|ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens GN=ZNF200 PE=2 SV=2 371 494 1.0E-10
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 337 433 1.0E-10
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 337 442 1.0E-10
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 341 418 1.0E-10
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 341 433 1.0E-10
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 341 416 1.0E-10
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 341 416 1.0E-10
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 337 443 1.0E-10
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 341 416 1.0E-10
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 341 449 2.0E-10
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 334 418 2.0E-10
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 354 443 2.0E-10
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 297 442 2.0E-10
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 343 442 2.0E-10
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 335 443 2.0E-10
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 349 443 2.0E-10
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 345 443 2.0E-10
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 307 449 2.0E-10
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 341 443 2.0E-10
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 337 442 2.0E-10
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 341 418 2.0E-10
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 326 463 2.0E-10
sp|P18728|ZG53_XENLA Gastrula zinc finger protein XlCGF53.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 334 443 2.0E-10
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 341 418 2.0E-10
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 337 422 2.0E-10
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 341 416 2.0E-10
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 337 481 2.0E-10
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 341 416 2.0E-10
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 358 443 2.0E-10
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 360 442 2.0E-10
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 345 442 2.0E-10
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 334 443 2.0E-10
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 337 442 2.0E-10
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 341 424 2.0E-10
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 337 418 2.0E-10
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 319 442 2.0E-10
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 362 442 2.0E-10
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 356 443 2.0E-10
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 418 2.0E-10
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 341 416 2.0E-10
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 444 2.0E-10
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 361 442 3.0E-10
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 355 443 3.0E-10
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 347 445 3.0E-10
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 339 420 3.0E-10
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 341 481 3.0E-10
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 341 424 3.0E-10
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 3.0E-10
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 334 483 3.0E-10
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 359 442 3.0E-10
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 341 443 3.0E-10
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 341 434 3.0E-10
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 331 443 3.0E-10
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 341 443 3.0E-10
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 362 445 3.0E-10
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 362 445 3.0E-10
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 3.0E-10
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 422 3.0E-10
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 359 443 3.0E-10
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 362 443 4.0E-10
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 362 443 4.0E-10
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 337 443 4.0E-10
sp|Q5U4E2|REPI1_MOUSE Replication initiator 1 OS=Mus musculus GN=Repin1 PE=1 SV=1 369 445 4.0E-10
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 354 418 4.0E-10
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 341 424 4.0E-10
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 359 442 4.0E-10
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 336 443 4.0E-10
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 341 416 4.0E-10
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 337 481 4.0E-10
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 341 443 4.0E-10
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 322 420 4.0E-10
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 340 443 4.0E-10
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 341 416 4.0E-10
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 347 443 5.0E-10
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 341 418 5.0E-10
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 334 422 5.0E-10
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 334 422 5.0E-10
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 334 422 5.0E-10
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 341 422 5.0E-10
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 334 422 5.0E-10
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 341 424 5.0E-10
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 341 424 5.0E-10
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 341 424 5.0E-10
sp|P18745|ZO22_XENLA Oocyte zinc finger protein XlCOF22 OS=Xenopus laevis PE=3 SV=1 341 421 5.0E-10
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 331 424 5.0E-10
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 334 443 5.0E-10
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 336 433 5.0E-10
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 337 433 5.0E-10
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 443 6.0E-10
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 355 443 6.0E-10
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 334 445 6.0E-10
sp|Q68H95|REPI1_RAT Replication initiator 1 OS=Rattus norvegicus GN=Repin1 PE=2 SV=1 370 445 6.0E-10
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 341 403 6.0E-10
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 341 420 6.0E-10
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 442 6.0E-10
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 336 545 6.0E-10
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 341 443 6.0E-10
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 341 481 6.0E-10
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 348 443 7.0E-10
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 372 449 7.0E-10
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 342 443 7.0E-10
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 355 443 7.0E-10
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 345 443 7.0E-10
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 423 7.0E-10
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 360 449 7.0E-10
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 341 443 7.0E-10
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 356 445 8.0E-10
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 341 443 8.0E-10
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 341 416 8.0E-10
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 365 449 9.0E-10
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 337 442 9.0E-10
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 9.0E-10
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 341 416 9.0E-10
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 332 443 1.0E-09
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 362 443 1.0E-09
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 343 428 1.0E-09
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 354 443 1.0E-09
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 331 436 1.0E-09
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 341 416 1.0E-09
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 371 443 1.0E-09
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 341 416 1.0E-09
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 341 416 1.0E-09
sp|Q9Y3M9|ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens GN=ZNF337 PE=1 SV=2 334 434 1.0E-09
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 341 418 1.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 442 1.0E-09
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 334 483 1.0E-09
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 341 443 1.0E-09
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 361 443 1.0E-09
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 341 416 1.0E-09
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 1.0E-09
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 341 442 1.0E-09
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 341 443 1.0E-09
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 341 425 1.0E-09
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 341 443 1.0E-09
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 341 445 1.0E-09
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 330 443 1.0E-09
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 416 2.0E-09
sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus GN=REPIN1 PE=2 SV=1 367 445 2.0E-09
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 339 443 2.0E-09
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 370 506 2.0E-09
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 370 506 2.0E-09
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 341 418 2.0E-09
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 443 2.0E-09
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 345 443 2.0E-09
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 425 2.0E-09
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 331 416 2.0E-09
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 341 443 2.0E-09
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 341 443 2.0E-09
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 341 443 2.0E-09
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 360 453 2.0E-09
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 351 443 2.0E-09
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 341 447 2.0E-09
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 354 443 2.0E-09
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 341 416 2.0E-09
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 331 443 2.0E-09
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 345 443 2.0E-09
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 443 2.0E-09
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 342 434 3.0E-09
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 359 442 3.0E-09
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 341 443 3.0E-09
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 341 443 3.0E-09
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 341 444 3.0E-09
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 341 418 3.0E-09
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 341 421 3.0E-09
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 371 443 4.0E-09
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 334 443 4.0E-09
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 358 447 4.0E-09
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 327 443 4.0E-09
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 341 443 4.0E-09
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 330 445 4.0E-09
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 371 443 5.0E-09
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 341 450 5.0E-09
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 341 429 5.0E-09
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 341 418 5.0E-09
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 341 442 5.0E-09
sp|P98182|ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens GN=ZNF200 PE=2 SV=2 337 420 5.0E-09
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 362 443 5.0E-09
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 341 416 6.0E-09
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 341 416 6.0E-09
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 360 442 6.0E-09
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 354 443 6.0E-09
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 358 443 6.0E-09
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 341 418 6.0E-09
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 347 443 7.0E-09
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 336 442 7.0E-09
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 369 443 7.0E-09
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 360 443 7.0E-09
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 359 433 7.0E-09
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 337 416 7.0E-09
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 364 443 7.0E-09
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 355 442 7.0E-09
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 337 425 7.0E-09
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 363 443 7.0E-09
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 336 442 8.0E-09
sp|Q8N8J6|ZN615_HUMAN Zinc finger protein 615 OS=Homo sapiens GN=ZNF615 PE=2 SV=2 346 443 8.0E-09
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 341 424 8.0E-09
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 341 443 8.0E-09
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 333 474 8.0E-09
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 341 442 8.0E-09
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 8.0E-09
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 337 433 9.0E-09
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 358 481 9.0E-09
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 341 443 9.0E-09
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 370 485 1.0E-08
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 337 424 1.0E-08
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 339 420 1.0E-08
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 358 481 1.0E-08
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 345 443 1.0E-08
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 343 443 1.0E-08
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 345 442 1.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 360 443 1.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 337 442 1.0E-08
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 362 443 1.0E-08
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 336 416 1.0E-08
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 362 443 1.0E-08
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 344 444 1.0E-08
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 354 443 2.0E-08
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 371 443 2.0E-08
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 360 442 2.0E-08
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 371 433 2.0E-08
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 339 420 2.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 343 443 2.0E-08
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 307 443 2.0E-08
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 359 447 2.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 362 433 2.0E-08
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 371 449 2.0E-08
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 341 420 2.0E-08
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 316 443 2.0E-08
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 331 443 2.0E-08
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 371 481 2.0E-08
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 341 443 2.0E-08
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 333 416 2.0E-08
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 345 481 2.0E-08
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 343 466 3.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 337 401 3.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 363 442 3.0E-08
sp|Q5R4K8|ZN615_PONAB Zinc finger protein 615 OS=Pongo abelii GN=ZNF615 PE=2 SV=2 346 443 3.0E-08
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 340 442 3.0E-08
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 370 485 3.0E-08
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 345 443 3.0E-08
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 339 447 3.0E-08
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 339 447 3.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 416 3.0E-08
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 359 443 3.0E-08
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 339 442 3.0E-08
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 336 443 3.0E-08
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 351 416 3.0E-08
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 370 443 3.0E-08
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 362 443 3.0E-08
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 333 416 3.0E-08
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 339 447 4.0E-08
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 339 447 4.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 341 443 4.0E-08
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 337 443 4.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 333 442 4.0E-08
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 339 442 4.0E-08
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 337 416 5.0E-08
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 370 485 5.0E-08
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 341 443 5.0E-08
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 339 447 5.0E-08
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 362 481 5.0E-08
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 341 422 6.0E-08
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 322 443 6.0E-08
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 371 449 6.0E-08
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 362 443 7.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 339 443 7.0E-08
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 341 418 7.0E-08
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 345 442 7.0E-08
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 341 481 7.0E-08
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 362 443 8.0E-08
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 362 443 8.0E-08
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 354 443 8.0E-08
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 331 443 8.0E-08
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 341 439 8.0E-08
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 336 454 9.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 341 443 1.0E-07
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 339 447 1.0E-07
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 369 443 1.0E-07
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 339 434 1.0E-07
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 328 443 1.0E-07
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 362 449 1.0E-07
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 347 443 1.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 362 442 1.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 354 481 2.0E-07
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 354 442 2.0E-07
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 354 497 2.0E-07
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 331 443 2.0E-07
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 341 416 2.0E-07
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 372 443 2.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 324 466 2.0E-07
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 362 443 2.0E-07
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 341 418 2.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 341 405 2.0E-07
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 362 443 2.0E-07
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 341 443 2.0E-07
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 339 441 2.0E-07
sp|Q92664|TF3A_HUMAN Transcription factor IIIA OS=Homo sapiens GN=GTF3A PE=1 SV=3 331 450 2.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 334 424 2.0E-07
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 362 443 2.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 341 443 3.0E-07
sp|Q5U4E2|REPI1_MOUSE Replication initiator 1 OS=Mus musculus GN=Repin1 PE=1 SV=1 339 442 3.0E-07
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 337 443 3.0E-07
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 371 449 3.0E-07
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 333 416 3.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 343 443 4.0E-07
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 341 424 4.0E-07
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 341 443 4.0E-07
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 339 443 4.0E-07
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 341 416 4.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 339 423 4.0E-07
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 289 435 4.0E-07
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 337 409 4.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 341 433 4.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 341 418 5.0E-07
sp|Q68H95|REPI1_RAT Replication initiator 1 OS=Rattus norvegicus GN=Repin1 PE=2 SV=1 339 442 5.0E-07
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 360 497 6.0E-07
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 336 442 6.0E-07
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 371 435 6.0E-07
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 371 435 6.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 372 443 6.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 357 443 6.0E-07
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 362 434 6.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 366 443 6.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 341 391 7.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 360 443 7.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 386 481 7.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 386 481 7.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 334 392 7.0E-07
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 327 421 7.0E-07
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 369 442 7.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 359 424 7.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 345 443 7.0E-07
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 343 421 7.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 358 443 8.0E-07
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 336 442 8.0E-07
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 341 442 8.0E-07
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 337 416 8.0E-07
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 341 442 9.0E-07
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 329 412 9.0E-07
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 337 416 9.0E-07
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 369 442 9.0E-07
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 348 443 9.0E-07
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 341 416 9.0E-07
sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens GN=REPIN1 PE=1 SV=1 362 450 1.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 357 443 1.0E-06
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 343 444 1.0E-06
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 334 402 1.0E-06
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 334 423 1.0E-06
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 341 401 2.0E-06
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 373 443 2.0E-06
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 362 481 2.0E-06
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 362 424 2.0E-06
sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus GN=REPIN1 PE=2 SV=1 362 450 2.0E-06
sp|Q5U4E2|REPI1_MOUSE Replication initiator 1 OS=Mus musculus GN=Repin1 PE=1 SV=1 334 449 2.0E-06
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 341 406 2.0E-06
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 341 404 2.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 347 443 2.0E-06
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 305 481 2.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 341 395 2.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 341 395 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 341 416 3.0E-06
sp|Q68H95|REPI1_RAT Replication initiator 1 OS=Rattus norvegicus GN=Repin1 PE=2 SV=1 362 450 3.0E-06
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 390 442 3.0E-06
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 380 444 3.0E-06
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 332 412 3.0E-06
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 306 443 3.0E-06
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 341 443 3.0E-06
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 341 395 3.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 364 445 3.0E-06
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 341 443 3.0E-06
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 341 395 3.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 364 445 3.0E-06
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 341 397 4.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 341 401 4.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 389 442 4.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 354 442 4.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 354 441 4.0E-06
sp|Q5ZM39|BCL6_CHICK B-cell lymphoma 6 protein homolog OS=Gallus gallus GN=BCL6 PE=2 SV=1 369 442 4.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 341 397 5.0E-06
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 286 443 5.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 351 442 5.0E-06
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 362 442 5.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 341 443 5.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 380 443 5.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 337 393 6.0E-06
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 341 423 6.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 389 481 6.0E-06
sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus GN=REPIN1 PE=2 SV=1 339 442 6.0E-06
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 331 451 7.0E-06
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 358 443 7.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 341 389 8.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 334 420 8.0E-06
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 345 443 8.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 376 443 9.0E-06
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 362 442 9.0E-06
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 340 443 9.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 341 395 1.0E-05
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 345 442 1.0E-05
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 367 445 1.0E-05
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 367 445 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7051
MTRRGRPRSVNNDTPPPGTEWLPLMQALHIGPLLPPLCRTPWTPFYIVLVGGSLKKTKKKNKTKRALVVGLALVA
RLTFTGKLALTASPAAAPTWGRWPQQPPTDFSMMDAPSFLPYDSRNTHMQRPLPPQYVVGPTYSSSMPSSAPPPP
PPPPPPPPPPPHPYSNQQAFAYVPYQSPPPSTPIGSPFKHDSHQRSVLAQRMAPPPDAEVARQMPFRRGSKSLSD
ARRQSPSVRSESQASSTARSLASNPTANSKTITYNETINPADRINFETDVDELMKAIQKKDDDEDDEPVRGQAPT
PAHTPPGSDAVPGPQSPVRPPTPPRSTVKSKKKWVCDGPSCNKRFVQKTHLDIHRRTHTGLKPYVCTKDNCGLTF
SQRGNLKTHMRRHTGEKPFSCSICGKLFAQRGNVRSHEETHKGLKPFICRLDDCHKTFSQLGNMKTHQNNFHKET
LQRLTTMFVKCAQMGEIPDEHQELFEYFKAHYKNSNKGIKGRGKARTVAPKAPKSDAHSQQQYQQQQQQQQQQQQ
HQQTQPQPQPQPPSLAFPHHLPMPNPQQPPQSTYVPGPAGPMASIPRHTHQHQHQHQHQHHPGMFDPPQHHSSNG
GGGSGMLYEDEHARQMAFSTDRLYPQNERHF
Coding >Ophio5|7051
ATGACGAGGCGAGGCCGGCCTCGATCAGTCAACAACGACACACCCCCTCCTGGGACCGAGTGGTTACCTCTAATG
CAGGCGCTACATATTGGACCCCTTCTCCCGCCTCTCTGCCGCACACCCTGGACGCCATTTTACATCGTCCTCGTC
GGCGGCTCCCTCAAAAAAACAAAAAAAAAAAACAAAACAAAACGGGCCCTCGTCGTCGGTCTTGCTCTCGTGGCG
AGGCTGACCTTCACCGGCAAACTGGCTTTAACGGCATCACCAGCGGCGGCCCCGACTTGGGGACGCTGGCCACAG
CAGCCTCCGACCGATTTCTCCATGATGGACGCGCCCAGCTTCTTGCCTTACGATTCTCGGAACACACACATGCAG
CGGCCCCTACCACCGCAATATGTCGTGGGCCCGACCTACAGCTCCTCCATGCCGAGCTCGGCGCCGCCTCCGCCT
CCTCCTCCTCCTCCGCCGCCGCCGCCGCCGCCGCATCCTTACTCGAATCAGCAAGCCTTCGCTTACGTCCCCTAC
CAAAGTCCGCCGCCATCAACACCCATCGGATCACCTTTCAAACATGACTCGCATCAACGATCGGTCCTGGCTCAG
AGGATGGCTCCGCCGCCAGACGCTGAGGTTGCTCGTCAAATGCCCTTCCGGCGGGGATCCAAGTCCCTGAGCGAC
GCCAGACGCCAGTCTCCCTCAGTGAGGAGCGAGTCCCAGGCCTCGTCCACCGCACGCTCCTTGGCCTCAAATCCG
ACGGCCAACTCCAAAACCATTACGTACAATGAGACCATCAATCCCGCCGATCGCATCAACTTTGAGACCGATGTC
GACGAGCTCATGAAGGCCATCCAGAAGAAAGATGATGACGAAGACGACGAGCCCGTTCGTGGCCAGGCGCCTACG
CCTGCCCACACTCCCCCTGGCTCCGACGCCGTGCCCGGCCCGCAAAGTCCCGTCCGGCCACCAACGCCCCCCCGA
TCGACAGTCAAGTCGAAGAAGAAATGGGTTTGCGATGGCCCCAGCTGCAACAAGCGCTTTGTCCAGAAAACGCAC
CTTGATATCCACCGTCGTACCCACACTGGTTTGAAGCCTTACGTTTGCACCAAGGACAATTGTGGTCTCACCTTC
TCACAGCGAGGCAACCTCAAGACGCACATGAGGCGCCACACTGGAGAAAAGCCCTTTTCATGCAGCATCTGCGGC
AAGCTCTTCGCTCAGCGTGGCAATGTTCGCTCCCATGAAGAGACGCACAAGGGTCTTAAGCCCTTCATCTGCCGC
CTCGATGACTGCCACAAGACCTTTTCTCAGCTTGGCAACATGAAGACGCACCAGAACAACTTCCACAAGGAGACG
CTGCAGCGGCTCACCACCATGTTCGTCAAGTGTGCGCAGATGGGAGAGATCCCTGACGAGCACCAGGAACTCTTC
GAGTACTTCAAGGCTCATTACAAAAACAGCAACAAAGGAATCAAGGGCCGTGGTAAGGCTCGCACCGTCGCCCCA
AAGGCGCCCAAGAGCGATGCCCACTCTCAGCAGCAATATCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAG
CACCAGCAGACGCAGCCGCAGCCGCAGCCGCAGCCACCGTCTCTGGCTTTCCCGCATCACCTGCCCATGCCCAAC
CCCCAGCAGCCGCCGCAGTCGACGTACGTCCCTGGCCCGGCTGGTCCCATGGCAAGCATCCCCCGTCACACCCAC
CAGCACCAGCATCAGCACCAGCACCAGCACCACCCCGGCATGTTTGACCCGCCGCAGCATCATTCCAGCAACGGC
GGGGGAGGGTCCGGTATGCTTTACGAGGATGAGCACGCGCGGCAGATGGCCTTTTCGACCGATCGCCTGTACCCT
CAAAACGAGCGACACTTT
Transcript >Ophio5|7051
ATGACGAGGCGAGGCCGGCCTCGATCAGTCAACAACGACACACCCCCTCCTGGGACCGAGTGGTTACCTCTAATG
CAGGCGCTACATATTGGACCCCTTCTCCCGCCTCTCTGCCGCACACCCTGGACGCCATTTTACATCGTCCTCGTC
GGCGGCTCCCTCAAAAAAACAAAAAAAAAAAACAAAACAAAACGGGCCCTCGTCGTCGGTCTTGCTCTCGTGGCG
AGGCTGACCTTCACCGGCAAACTGGCTTTAACGGCATCACCAGCGGCGGCCCCGACTTGGGGACGCTGGCCACAG
CAGCCTCCGACCGATTTCTCCATGATGGACGCGCCCAGCTTCTTGCCTTACGATTCTCGGAACACACACATGCAG
CGGCCCCTACCACCGCAATATGTCGTGGGCCCGACCTACAGCTCCTCCATGCCGAGCTCGGCGCCGCCTCCGCCT
CCTCCTCCTCCTCCGCCGCCGCCGCCGCCGCCGCATCCTTACTCGAATCAGCAAGCCTTCGCTTACGTCCCCTAC
CAAAGTCCGCCGCCATCAACACCCATCGGATCACCTTTCAAACATGACTCGCATCAACGATCGGTCCTGGCTCAG
AGGATGGCTCCGCCGCCAGACGCTGAGGTTGCTCGTCAAATGCCCTTCCGGCGGGGATCCAAGTCCCTGAGCGAC
GCCAGACGCCAGTCTCCCTCAGTGAGGAGCGAGTCCCAGGCCTCGTCCACCGCACGCTCCTTGGCCTCAAATCCG
ACGGCCAACTCCAAAACCATTACGTACAATGAGACCATCAATCCCGCCGATCGCATCAACTTTGAGACCGATGTC
GACGAGCTCATGAAGGCCATCCAGAAGAAAGATGATGACGAAGACGACGAGCCCGTTCGTGGCCAGGCGCCTACG
CCTGCCCACACTCCCCCTGGCTCCGACGCCGTGCCCGGCCCGCAAAGTCCCGTCCGGCCACCAACGCCCCCCCGA
TCGACAGTCAAGTCGAAGAAGAAATGGGTTTGCGATGGCCCCAGCTGCAACAAGCGCTTTGTCCAGAAAACGCAC
CTTGATATCCACCGTCGTACCCACACTGGTTTGAAGCCTTACGTTTGCACCAAGGACAATTGTGGTCTCACCTTC
TCACAGCGAGGCAACCTCAAGACGCACATGAGGCGCCACACTGGAGAAAAGCCCTTTTCATGCAGCATCTGCGGC
AAGCTCTTCGCTCAGCGTGGCAATGTTCGCTCCCATGAAGAGACGCACAAGGGTCTTAAGCCCTTCATCTGCCGC
CTCGATGACTGCCACAAGACCTTTTCTCAGCTTGGCAACATGAAGACGCACCAGAACAACTTCCACAAGGAGACG
CTGCAGCGGCTCACCACCATGTTCGTCAAGTGTGCGCAGATGGGAGAGATCCCTGACGAGCACCAGGAACTCTTC
GAGTACTTCAAGGCTCATTACAAAAACAGCAACAAAGGAATCAAGGGCCGTGGTAAGGCTCGCACCGTCGCCCCA
AAGGCGCCCAAGAGCGATGCCCACTCTCAGCAGCAATATCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAG
CACCAGCAGACGCAGCCGCAGCCGCAGCCGCAGCCACCGTCTCTGGCTTTCCCGCATCACCTGCCCATGCCCAAC
CCCCAGCAGCCGCCGCAGTCGACGTACGTCCCTGGCCCGGCTGGTCCCATGGCAAGCATCCCCCGTCACACCCAC
CAGCACCAGCATCAGCACCAGCACCAGCACCACCCCGGCATGTTTGACCCGCCGCAGCATCATTCCAGCAACGGC
GGGGGAGGGTCCGGTATGCTTTACGAGGATGAGCACGCGCGGCAGATGGCCTTTTCGACCGATCGCCTGTACCCT
CAAAACGAGCGACACTTTTGA
Gene >Ophio5|7051
ATGACGAGGCGAGGCCGGCCTCGATCAGTCAACAACGACACACCCCCTCCTGGGACCGAGTGGTTACCTCTAATG
CAGGCGTACCTCAAGTCAAGATCTCTGAAGCCAGACCCAGACGATTGGCTACCACCCTGGTTCCAAGCCTGGCCG
CCCATGGCCCGTCCACTGGCACCCGTCGTTTGCTCGTCGGGCTTCTGAGATAGGCTACATATTGGACCCCTTCTC
CCGCCTCTCTGCCGCACGTATGTCCCTCATCTTTCCTGGTCACGTCTTCACAACGACCCAAAGCCCTCCCGTCCC
CTTGCTCCCTTGGTCTCACCATTTCCCGTCGAGCTTCTGTTTGTGTGTTGCTCACTCGCCTTTGGTGACTAGACC
CTGGACGCCATTTTACATCGTCCTCGTCGGCGGCTCCCTCAAAAAAACAAAAAAAAAAAACAAAACAAAACGGGC
CCTCGTCGTCGGTCTTGCTCTCGTGGCGAGGCTGACCTTCACCGGCAAACTGGCTTTAACGGCATCACCAGCGGC
GGCCCCGACTTGGGGACGCTGGCCACAGCAGCCTCCGACCGATTTCTCCATGATGGACGCGCCCAGCTTCTTGCC
TTACGATTCTCGGAACACACACATGCAGCGGCCCCTACCACCGCAATATGTCGTGGGCCCGACCTACAGCTCCTC
CATGCCGAGCTCGGCGCCGCCTCCGCCTCCTCCTCCTCCTCCGCCGCCGCCGCCGCCGCCGCATCCTTACTCGAA
TCAGCAAGCCTTCGCTTACGTCCCCTACCAAAGTCCGCCGCCATCAACACCCATCGGATCACCTTTCAAACATGA
CTCGCATCAACGATCGGTCCTGGCTCAGAGGATGGCTCCGCCGCCAGACGCTGAGGTTGCTCGTCAAATGCCCTT
CCGGCGGGGATCCAAGTCCCTGAGCGACGCCAGACGCCAGTCTCCCTCAGTGAGGAGCGAGTCCCAGGCCTCGTC
CACCGCACGCTCCTTGGCCTCAAATCCGACGGCCAACTCCAAAACCATTACGTACAATGAGACCATCAATCCCGC
CGATCGCATCAACTTTGAGACCGATGTCGACGAGCTCATGAAGGCCATCCAGAAGAAAGATGATGACGAAGACGA
CGAGCCCGTTCGTGGCCAGGCGCCTACGCCTGCCCACACTCCCCCTGGCTCCGACGCCGTGCCCGGCCCGCAAAG
TCCCGTCCGGCCACCAACGCCCCCCCGATCGACAGTCAAGTCGAAGAAGAAATGGGTTTGCGATGGCCCCAGCTG
CAACAAGCGCTTTGTCCAGAAAACGCACCTTGATATCCACCGTCGTACCCACACTGGTTTGAAGCCTTACGTGAG
TTCTTGGACCCCTACGTAATGATGTGAAGGACATTGTCTAATGACGGATCCACCAGGTTTGCACCAAGGACAATT
GTGGTCTCACCTTCTCACAGCGAGGCAACCTCAAGGTAATTTCCTTCACGTCTTCGACTCTATCCATTCACGACT
AACGAAATCCACAGACGCACATGAGGCGCCACACTGGAGAAAAGCCCTTTTCATGCAGCATCTGCGGCAAGCTCT
TCGCTCAGCGTGGCAATGTTCGCTCCCATGAAGAGACGCACAAGGGTCTTAAGCCCTTCATCTGCCGCCTCGATG
ACTGCCACAAGACCTTTTCTCAGCTTGGCAACATGAAGGTACGCTTTCATGGGCCATGCTGAATGCAGCCCCTGA
CTGACTTGTCCCAGACGCACCAGAACAACTTCCACAAGGAGACGCTGCAGCGGCTCACCACCATGTTCGTCAAGT
GTGCGCAGATGGGAGAGATCCCTGACGAGCACCAGGAACTCTTCGAGTACTTCAAGGCTCATTACAAAAACAGCA
ACAAAGGAATCAAGGGCCGTGGTAAGGCTCGCACCGTCGCCCCAAAGGCGCCCAAGAGCGATGCCCACTCTCAGC
AGCAATATCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAGCACCAGCAGACGCAGCCGCAGCCGCAGCCGC
AGCCACCGTCTCTGGCTTTCCCGCATCACCTGCCCATGCCCAACCCCCAGCAGCCGCCGCAGTCGACGTACGTCC
CTGGCCCGGCTGGTCCCATGGCAAGCATCCCCCGTCACACCCACCAGCACCAGCATCAGCACCAGCACCAGCACC
ACCCCGGCATGTTTGACCCGCCGCAGCATCATTCCAGCAACGGCGGGGGAGGGTCCGGTATGCTTTACGAGGATG
AGCACGCGCGGCAGATGGCCTTTTCGACCGATCGCCTGTACCCTCAAAACGAGCGACACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail