Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7047
Gene name
Locationscaffold_650:7336..10089
Strand+
Gene length (bp)2753
Transcript length (bp)2694
Coding sequence length (bp)2691
Protein length (aa) 897

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00350 Dynamin_N Dynamin family 4.3E-17 259 429
PF01926 MMR_HSR1 50S ribosome-binding GTPase 7.2E-09 258 429

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USY7|FZO1_SCHPO Transmembrane GTPase fzo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fzo1 PE=3 SV=1 89 890 9.0E-127
sp|P38297|FZO1_YEAST Mitofusin FZO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FZO1 PE=1 SV=1 202 890 9.0E-119

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7047
MSQDYFSGKGKSRARGDSDADAQQSAAPPNYLTVGTGSTSEHASRLLNMLDVDSGYGGSVSGEEPRAAMARASRT
EAVHHDRPQAGVLHQMWYNSQRATLGRSINKVLDLLQNLREMNTAWPAHYPSVQRDATSERPSSRPGIPHTQSTM
EGFAGANPAHGDFPTPLRRSMTTVEASSAESSRAAENRPAPEPRLVSPQIAQEFSILKLDLKLGSFNQVELVHSL
EKGSIASLLDGKISSSMKHLLSLRERIEDTSSKVLITGDLNAGKSTFCNALLRRKLLPEDQQPCTAIFCEVLDAR
ANAGIEEVHAVHKDAAYNRNDESTYDVFALVDLEKIVSDNETYTQCKVYVKDIRTIDESLLNNGVVDIALIDAPG
LNSDTTKTTAIFARQEEIDVVVFVVSAANHFTQSAKEFIWAAAAEKAYLFIVVNGYDAIRDKDRCQKLILDQVSG
LSPRTFKESSELVHFVSSNAIPAGPSPPGGPGGGGSGSSSGGGGDDDPDGGDSGPDKGKGKGKDLDKQRKFEALE
QSLRRFVLEKRARSKLAPARTYLLNILNDVNTLATVNQGVAQSELNRVTAELRTLEPQLETSRRAVSEVGDQIDQ
EVEDVCKDVYDHTRAEINAAITYAGKSNHDVPYPGFLSAFQYADELKEAMLSHIADAVSDCEEYARNKSVQGVNV
IKQLGLLHVGDEFQSLQFRPDVMFRRKRDALARQVDVPTELSDFVDWSTLLQRQEKFAGTGMALTLAGAFVPRIM
GMSNWMDQALTATRLLSNENLQRLVLPGIFVAAVAATAYVLQQIPNSLPPRLATKISTQLAELDYVHANSTRISS
SVHKVLRYPAETLRVGLDQSVKDLGNRLDETVKVKGESERAAKFFRDLVGESQVQRSMVEAVDLDAPPPGLR
Coding >Ophio5|7047
ATGAGCCAAGACTATTTCTCCGGCAAGGGAAAATCCCGCGCGCGCGGCGACTCCGACGCCGACGCGCAGCAAAGC
GCCGCGCCTCCCAACTATTTGACCGTCGGCACCGGCTCCACCTCAGAACATGCGTCACGTCTCCTGAATATGCTG
GATGTCGACTCCGGCTACGGTGGCAGCGTCTCGGGCGAGGAGCCCCGAGCAGCCATGGCCCGGGCTTCGCGGACC
GAAGCCGTGCATCACGATCGCCCCCAGGCCGGCGTCCTACACCAGATGTGGTACAATTCGCAACGAGCCACACTG
GGCCGGTCCATCAACAAGGTTCTGGATCTGCTCCAGAACTTGCGGGAGATGAACACAGCGTGGCCGGCACACTAT
CCGTCTGTCCAGCGAGATGCCACTTCAGAACGACCCTCGTCACGGCCCGGTATCCCGCACACGCAGTCGACGATG
GAGGGGTTTGCCGGTGCAAATCCCGCTCACGGAGATTTCCCGACCCCTCTCCGAAGGTCTATGACCACGGTCGAA
GCGTCGTCTGCCGAGTCCAGTCGAGCGGCCGAAAATCGACCGGCTCCTGAGCCACGGCTGGTCTCGCCCCAGATT
GCGCAAGAATTTTCGATACTTAAGCTTGACTTGAAACTGGGGTCCTTCAATCAAGTCGAGCTAGTACACTCACTC
GAGAAGGGCTCGATTGCGTCGCTCCTCGATGGGAAAATCAGCTCCAGCATGAAGCACCTGCTTTCCCTCCGGGAG
CGCATTGAAGACACCTCTAGCAAGGTCCTCATCACAGGGGACCTCAATGCGGGAAAGTCGACTTTCTGCAACGCT
CTTCTGCGGCGCAAGCTCTTGCCTGAGGACCAGCAACCCTGTACTGCCATCTTCTGCGAAGTGCTGGACGCGAGG
GCCAACGCTGGTATCGAGGAGGTGCACGCGGTTCACAAGGATGCTGCCTACAATCGAAACGATGAGTCGACCTAC
GACGTCTTTGCCCTGGTGGACCTGGAGAAGATTGTTAGCGACAACGAAACATACACTCAGTGCAAGGTCTATGTC
AAGGATATCAGAACCATCGATGAATCCTTACTGAATAACGGAGTTGTGGACATTGCACTCATCGACGCGCCCGGC
CTCAACTCGGATACGACGAAAACGACGGCCATCTTCGCCAGGCAAGAGGAGATTGACGTCGTGGTTTTCGTCGTG
TCTGCGGCCAATCACTTCACGCAGTCGGCCAAGGAGTTCATCTGGGCCGCGGCAGCGGAGAAGGCCTATCTCTTT
ATAGTTGTCAACGGCTACGACGCTATTCGAGACAAGGACCGGTGCCAGAAGCTGATATTGGATCAAGTCTCGGGA
CTCAGTCCGCGGACGTTCAAAGAGTCGTCAGAGCTCGTTCACTTCGTGTCCAGCAACGCGATCCCTGCCGGCCCG
TCGCCTCCAGGCGGACCTGGAGGCGGCGGCAGTGGAAGCTCCAGCGGAGGGGGTGGTGACGATGATCCCGACGGC
GGCGACTCCGGCCCCGACAAGGGCAAGGGCAAGGGCAAGGACTTGGACAAGCAACGCAAGTTTGAGGCTCTGGAA
CAGTCATTACGGCGGTTCGTGCTGGAGAAGCGTGCGCGTTCCAAGCTTGCGCCCGCGAGGACCTACCTGTTGAAC
ATCTTGAACGACGTCAACACTCTGGCCACGGTCAACCAGGGTGTGGCGCAGTCCGAGCTGAACCGAGTCACGGCT
GAGCTCAGGACCCTTGAACCGCAGCTGGAGACGAGCAGGAGAGCCGTATCAGAGGTTGGAGATCAAATTGATCAG
GAAGTGGAAGATGTCTGCAAAGACGTCTACGATCACACACGTGCCGAGATCAACGCCGCCATCACTTACGCAGGC
AAGTCTAACCACGACGTGCCATACCCCGGCTTCTTGAGCGCGTTCCAGTACGCCGACGAGCTTAAGGAGGCCATG
CTCTCTCACATAGCCGATGCCGTCAGCGACTGCGAGGAATACGCGCGCAACAAGTCGGTCCAAGGCGTCAACGTC
ATCAAGCAGCTCGGACTTCTTCACGTCGGAGACGAATTCCAGAGCCTTCAGTTCCGGCCCGACGTCATGTTCCGC
CGCAAGCGCGACGCCCTCGCCCGCCAGGTCGACGTCCCTACCGAGCTGTCGGACTTTGTCGACTGGTCCACGCTC
TTACAACGCCAGGAGAAGTTTGCCGGCACGGGCATGGCGCTGACGCTGGCGGGCGCCTTCGTGCCGCGCATCATG
GGCATGAGCAACTGGATGGATCAGGCGCTGACGGCGACGCGCCTCCTGAGTAACGAGAACCTGCAGCGGCTCGTA
CTCCCCGGCATCTTCGTGGCTGCCGTGGCCGCGACGGCGTACGTCCTACAGCAGATACCCAATTCGCTTCCGCCG
CGGCTGGCGACCAAGATCTCGACGCAGCTAGCGGAACTCGACTACGTGCACGCCAACTCGACGCGCATCTCGTCG
TCCGTCCACAAGGTGCTCCGCTACCCAGCCGAGACGCTGCGTGTCGGCCTCGACCAGAGCGTAAAGGACCTCGGC
AACCGGCTCGACGAGACGGTCAAGGTCAAGGGCGAGAGCGAGCGGGCTGCCAAGTTCTTCCGTGACCTCGTCGGT
GAGAGCCAGGTGCAGCGCAGTATGGTCGAGGCCGTGGATCTGGATGCCCCGCCGCCAGGCCTGCGC
Transcript >Ophio5|7047
ATGAGCCAAGACTATTTCTCCGGCAAGGGAAAATCCCGCGCGCGCGGCGACTCCGACGCCGACGCGCAGCAAAGC
GCCGCGCCTCCCAACTATTTGACCGTCGGCACCGGCTCCACCTCAGAACATGCGTCACGTCTCCTGAATATGCTG
GATGTCGACTCCGGCTACGGTGGCAGCGTCTCGGGCGAGGAGCCCCGAGCAGCCATGGCCCGGGCTTCGCGGACC
GAAGCCGTGCATCACGATCGCCCCCAGGCCGGCGTCCTACACCAGATGTGGTACAATTCGCAACGAGCCACACTG
GGCCGGTCCATCAACAAGGTTCTGGATCTGCTCCAGAACTTGCGGGAGATGAACACAGCGTGGCCGGCACACTAT
CCGTCTGTCCAGCGAGATGCCACTTCAGAACGACCCTCGTCACGGCCCGGTATCCCGCACACGCAGTCGACGATG
GAGGGGTTTGCCGGTGCAAATCCCGCTCACGGAGATTTCCCGACCCCTCTCCGAAGGTCTATGACCACGGTCGAA
GCGTCGTCTGCCGAGTCCAGTCGAGCGGCCGAAAATCGACCGGCTCCTGAGCCACGGCTGGTCTCGCCCCAGATT
GCGCAAGAATTTTCGATACTTAAGCTTGACTTGAAACTGGGGTCCTTCAATCAAGTCGAGCTAGTACACTCACTC
GAGAAGGGCTCGATTGCGTCGCTCCTCGATGGGAAAATCAGCTCCAGCATGAAGCACCTGCTTTCCCTCCGGGAG
CGCATTGAAGACACCTCTAGCAAGGTCCTCATCACAGGGGACCTCAATGCGGGAAAGTCGACTTTCTGCAACGCT
CTTCTGCGGCGCAAGCTCTTGCCTGAGGACCAGCAACCCTGTACTGCCATCTTCTGCGAAGTGCTGGACGCGAGG
GCCAACGCTGGTATCGAGGAGGTGCACGCGGTTCACAAGGATGCTGCCTACAATCGAAACGATGAGTCGACCTAC
GACGTCTTTGCCCTGGTGGACCTGGAGAAGATTGTTAGCGACAACGAAACATACACTCAGTGCAAGGTCTATGTC
AAGGATATCAGAACCATCGATGAATCCTTACTGAATAACGGAGTTGTGGACATTGCACTCATCGACGCGCCCGGC
CTCAACTCGGATACGACGAAAACGACGGCCATCTTCGCCAGGCAAGAGGAGATTGACGTCGTGGTTTTCGTCGTG
TCTGCGGCCAATCACTTCACGCAGTCGGCCAAGGAGTTCATCTGGGCCGCGGCAGCGGAGAAGGCCTATCTCTTT
ATAGTTGTCAACGGCTACGACGCTATTCGAGACAAGGACCGGTGCCAGAAGCTGATATTGGATCAAGTCTCGGGA
CTCAGTCCGCGGACGTTCAAAGAGTCGTCAGAGCTCGTTCACTTCGTGTCCAGCAACGCGATCCCTGCCGGCCCG
TCGCCTCCAGGCGGACCTGGAGGCGGCGGCAGTGGAAGCTCCAGCGGAGGGGGTGGTGACGATGATCCCGACGGC
GGCGACTCCGGCCCCGACAAGGGCAAGGGCAAGGGCAAGGACTTGGACAAGCAACGCAAGTTTGAGGCTCTGGAA
CAGTCATTACGGCGGTTCGTGCTGGAGAAGCGTGCGCGTTCCAAGCTTGCGCCCGCGAGGACCTACCTGTTGAAC
ATCTTGAACGACGTCAACACTCTGGCCACGGTCAACCAGGGTGTGGCGCAGTCCGAGCTGAACCGAGTCACGGCT
GAGCTCAGGACCCTTGAACCGCAGCTGGAGACGAGCAGGAGAGCCGTATCAGAGGTTGGAGATCAAATTGATCAG
GAAGTGGAAGATGTCTGCAAAGACGTCTACGATCACACACGTGCCGAGATCAACGCCGCCATCACTTACGCAGGC
AAGTCTAACCACGACGTGCCATACCCCGGCTTCTTGAGCGCGTTCCAGTACGCCGACGAGCTTAAGGAGGCCATG
CTCTCTCACATAGCCGATGCCGTCAGCGACTGCGAGGAATACGCGCGCAACAAGTCGGTCCAAGGCGTCAACGTC
ATCAAGCAGCTCGGACTTCTTCACGTCGGAGACGAATTCCAGAGCCTTCAGTTCCGGCCCGACGTCATGTTCCGC
CGCAAGCGCGACGCCCTCGCCCGCCAGGTCGACGTCCCTACCGAGCTGTCGGACTTTGTCGACTGGTCCACGCTC
TTACAACGCCAGGAGAAGTTTGCCGGCACGGGCATGGCGCTGACGCTGGCGGGCGCCTTCGTGCCGCGCATCATG
GGCATGAGCAACTGGATGGATCAGGCGCTGACGGCGACGCGCCTCCTGAGTAACGAGAACCTGCAGCGGCTCGTA
CTCCCCGGCATCTTCGTGGCTGCCGTGGCCGCGACGGCGTACGTCCTACAGCAGATACCCAATTCGCTTCCGCCG
CGGCTGGCGACCAAGATCTCGACGCAGCTAGCGGAACTCGACTACGTGCACGCCAACTCGACGCGCATCTCGTCG
TCCGTCCACAAGGTGCTCCGCTACCCAGCCGAGACGCTGCGTGTCGGCCTCGACCAGAGCGTAAAGGACCTCGGC
AACCGGCTCGACGAGACGGTCAAGGTCAAGGGCGAGAGCGAGCGGGCTGCCAAGTTCTTCCGTGACCTCGTCGGT
GAGAGCCAGGTGCAGCGCAGTATGGTCGAGGCCGTGGATCTGGATGCCCCGCCGCCAGGCCTGCGCTGA
Gene >Ophio5|7047
ATGAGCCAAGACTATTTCTCCGGCAAGGGAAAATCCCGCGCGCGCGGCGACTCCGACGCCGACGCGCAGCAAAGC
GCCGCGCCTCCCAACTATTTGACCGTCGGCACCGGCTCCACCTCAGAACATGCGTCACGTCTCCTGAATATGCTG
GATGTCGACTCCGGCTACGGTGGCAGCGTCTCGGGCGAGGAGCCCCGAGCAGCCATGGCCCGGGCTTCGCGGACC
GAAGCCGTGCATCACGATCGCCCCCAGGCCGGCGTCCTACACCAGATGTGGTACAATTCGCAACGAGCCACACTG
GGCCGGTCCATCAACAAGGTTCTGGATCTGCTCCAGAACTTGCGGGAGATGAACACAGCGTGGCCGGCACACTAT
CCGTCTGTCCAGCGAGATGCCACTTCAGAACGACCCTCGTCACGGCCCGGTATCCCGCACACGCAGTCGACGATG
GAGGGGTTTGCCGGTGCAAATCCCGCTCACGGAGATTTCCCGACCCCTCTCCGAAGGTCTATGACCACGGTCGAA
GCGTCGTCTGCCGAGTCCAGTCGAGCGGCCGAAAATCGACCGGCTCCTGAGCCACGGCTGGTCTCGCCCCAGATT
GCGCAAGAATTTTCGATACTTAAGCTTGACTTGAAACTGGGGTCCTTCAATCAAGTCGAGCTAGTACACTCACTC
GAGAAGGGCTCGATTGCGTCGCTCCTCGATGGGAAAATCAGCTCCAGCATGAAGCACCTGCTTTCCCTCCGGGAG
CGCATTGAAGACACCTCTAGCAAGGTCCTCATCACAGGGGACCTCAATGCGGGAAAGTCGACTTTCTGCAACGCT
CTTCTGCGGCGCAAGCTCTTGCCTGAGGACCAGCAACCCTGTACTGCCATCTTCTGCGAAGTGCTGGACGCGAGG
GCCAACGCTGGTATCGAGGAGGTGCACGCGGTTCACAAGGATGCTGCCTACAATCGAAACGATGAGTCGACCTAC
GACGTCTTTGCCCTGGTGGACCTGGAGAAGATTGTTAGCGACAACGAAACATACACTCAGTGCAAGGTCTATGTC
AAGGATATCAGAACCATCGATGAATCCTTACTGAATAACGGAGTTGTGGACATTGCACTCATCGACGCGCCCGGC
CTCAACTCGGATACGACGAAAACGACGGCCATCTTCGCCAGGCAAGAGGAGATTGACGTCGTGGTTTTCGTCGTG
TCTGCGGCCAATCACTTCACGCAGTCGGCCAAGGAGTTCATCTGGGCCGCGGCAGCGGAGAAGGCCTATCTCTTT
ATAGTTGTCAACGGCTACGACGCTATTCGAGACAAGGACCGGTGCCAGAAGCTGATATTGGATCAAGTCTCGGGA
CTCAGTCCGCGGACGTTCAAAGAGTCGTCAGAGCTCGTTCACTTCGTGTCCAGCAACGCGATCCCTGCCGGCCCG
TCGCCTCCAGGCGGACCTGGAGGCGGCGGCAGTGGAAGCTCCAGCGGAGGGGGTGGTGACGATGATCCCGACGGC
GGCGACTCCGGCCCCGACAAGGGCAAGGGCAAGGGCAAGGACTTGGACAAGCAACGCAAGTTTGAGGCTCTGGAA
CAGTCATTACGGCGGTTCGTGCTGGAGAAGCGTGCGCGTTCCAAGCTTGCGCCCGCGAGGACCTACCTGTTGAAC
ATCTTGAACGACGTCAACACTCTGGCCACGGTCAACCAGGGTGTGGCGCAGTCCGAGCTGAACCGAGTCACGGCT
GAGCTCAGGACCCTTGAACCGCAGCTGGAGACGAGCAGGAGAGCCGTATCAGAGGTTGGAGATCAAATTGATCAG
GAAGTGGAAGATGTCTGCAAAGACGTCTACGATCACACACGTGCCGAGATCAACGCCGCCATCACTTACGCAGGC
AAGTCTAACCACGACGTGCCATACCCCGGCTTCTTGAGCGCGTTCCAGTACGCCGACGAGCTTAAGGAGGCCATG
CTCTCTCACATAGCCGATGCCGTCAGCGACTGCGAGGAATACGCGCGCAACAAGTCGGTCCAAGGCGTCAACGTC
ATCAAGCAGCTCGGACTTCTTCACGTCGGAGACGAATTCCAGAGCCTTCAGTTCCGGCCCGACGTCATGTTCCGC
CGCAAGCGCGACGCCCTCGCCCGCCAGGTCGACGTCCCTACCGAGCTGTCGGACTTTGTCGACTGGTCCACGCTC
TTACAACGCCAGGAGAAGTTTGCCGGCACGGGCATGGCGCTGACGCTGGCGGGCGCCTTCGTGCCGCGCATCATG
GGCATGAGCAACTGGATGGATCAGGCGCTGACGGCGACGCGCCTCCTGAGTAACGAGAACCTGCAGCGGCTCGTA
CTCCCCGGCATCTTCGTGGCTGGTAAGCGTTTTCCTACTTGGCATACACAGACGGGCTCAGAGGCTGACATGAGA
GAATAGCCGTGGCCGCGACGGCGTACGTCCTACAGCAGATACCCAATTCGCTTCCGCCGCGGCTGGCGACCAAGA
TCTCGACGCAGCTAGCGGAACTCGACTACGTGCACGCCAACTCGACGCGCATCTCGTCGTCCGTCCACAAGGTGC
TCCGCTACCCAGCCGAGACGCTGCGTGTCGGCCTCGACCAGAGCGTAAAGGACCTCGGCAACCGGCTCGACGAGA
CGGTCAAGGTCAAGGGCGAGAGCGAGCGGGCTGCCAAGTTCTTCCGTGACCTCGTCGGTGAGAGCCAGGTGCAGC
GCAGTATGGTCGAGGCCGTGGATCTGGATGCCCCGCCGCCAGGCCTGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail