Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7040
Gene name
Locationscaffold_65:47983..49014
Strand+
Gene length (bp)1031
Transcript length (bp)921
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 4.9E-26 145 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59933|MSMO_CANAL Methylsterol monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG25 PE=3 SV=1 9 306 5.0E-125
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 5 305 2.0E-122
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 21 306 1.0E-118
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 29 301 2.0E-66
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 29 295 1.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59933|MSMO_CANAL Methylsterol monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG25 PE=3 SV=1 9 306 5.0E-125
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 5 305 2.0E-122
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 21 306 1.0E-118
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 29 301 2.0E-66
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 29 295 1.0E-65
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 57 297 9.0E-64
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 57 294 7.0E-62
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 57 294 7.0E-62
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 4 288 3.0E-60
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 57 294 5.0E-60
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 57 288 2.0E-59
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 57 294 7.0E-59
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 57 303 6.0E-58
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 33 304 4.0E-55
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 48 302 1.0E-50
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 81 306 2.0E-38
sp|F4JLZ6|SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana GN=SMO1-3 PE=2 SV=1 70 304 2.0E-38
sp|Q1EC69|SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana GN=SMO1-2 PE=2 SV=1 18 306 1.0E-36
sp|Q5PRC0|CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio GN=ch25h PE=2 SV=1 64 281 5.0E-29
sp|Q9Z0F5|CH25H_MOUSE Cholesterol 25-hydroxylase OS=Mus musculus GN=Ch25h PE=1 SV=1 63 305 1.0E-26
sp|Q4G1G8|CH25H_PIG Cholesterol 25-hydroxylase OS=Sus scrofa GN=CH25H PE=2 SV=1 65 287 4.0E-26
sp|Q1LX59|C2512_DANRE Cholesterol 25-hydroxylase-like protein 1, member 2 OS=Danio rerio GN=ch25hl1.2 PE=3 SV=1 47 283 8.0E-26
sp|Q4QQV7|CH25H_RAT Cholesterol 25-hydroxylase OS=Rattus norvegicus GN=Ch25h PE=2 SV=1 64 305 1.0E-24
sp|Q567X1|C25L1_DANRE Cholesterol 25-hydroxylase-like protein 1, member 1 OS=Danio rerio GN=ch25hl1.1 PE=2 SV=2 65 298 1.0E-21
sp|A8WGT1|C25L2_DANRE Cholesterol 25-hydroxylase-like protein 2 OS=Danio rerio GN=ch25hl2 PE=2 SV=1 24 298 5.0E-19
sp|O95992|CH25H_HUMAN Cholesterol 25-hydroxylase OS=Homo sapiens GN=CH25H PE=1 SV=1 64 281 9.0E-19
sp|Q20027|C25HL_CAEEL Cholesterol 25-hydroxylase-like protein OS=Caenorhabditis elegans GN=F35C8.5 PE=1 SV=1 73 297 1.0E-17
sp|Q618G2|C25HL_CAEBR Cholesterol 25-hydroxylase-like protein OS=Caenorhabditis briggsae GN=CBG14675 PE=3 SV=1 73 297 3.0E-17
sp|Q9GKT2|FXDC2_MACFA Fatty acid hydroxylase domain-containing protein 2 OS=Macaca fascicularis GN=FAXDC2 PE=2 SV=1 76 269 1.0E-15
sp|Q96IV6|FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens GN=FAXDC2 PE=2 SV=1 76 269 2.0E-14
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 109 287 7.0E-14
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 111 294 6.0E-12
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 140 298 4.0E-09
sp|O75845|SC5D_HUMAN Lathosterol oxidase OS=Homo sapiens GN=SC5D PE=1 SV=2 137 306 2.0E-08
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 135 296 3.0E-08
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 140 281 2.0E-07
sp|O88822|SC5D_MOUSE Lathosterol oxidase OS=Mus musculus GN=Sc5d PE=2 SV=2 134 276 3.0E-07
sp|Q9EQS5|SC5D_RAT Lathosterol oxidase OS=Rattus norvegicus GN=Sc5d PE=1 SV=1 134 276 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7040
MDVVNATAKALGNQTQDYFTVLDEVSKTSLHLNFAERLWAAWYLFMQNDTLATGIMSFVMHEIVYFGRCLPFIIM
DKIPYFQQYKIQNQKMPTLKEQWDCAAIVLVSHFTAELPQIWFFHPIATFFGMDYGVPFPPLWKMALQIAILFVM
EDTWHYWFHRCLHYGPLYKAIHKMHHTYSAPFGLAAEYASPIETMLLGMGVVGSPILMLCVTGDLHLITMYTWII
LRLFQAIDAHSGYDFPWSLRHFLPVWAGADHHDMHHEKFMGNYASSFRWWDYFLDTEAGPEAHRRRREKKLKAIR
EAKKQQ
Coding >Ophio5|7040
ATGGACGTCGTAAATGCCACAGCTAAAGCCCTGGGCAACCAGACCCAGGACTACTTTACCGTTCTCGATGAGGTC
TCCAAGACCAGTCTTCACCTCAACTTTGCCGAGCGTCTCTGGGCCGCTTGGTATCTTTTTATGCAGAATGACACC
CTCGCCACCGGCATCATGAGCTTCGTCATGCACGAGATTGTCTACTTTGGCCGCTGCCTTCCGTTCATCATCATG
GACAAGATCCCCTACTTCCAGCAGTACAAGATCCAGAACCAGAAGATGCCGACACTCAAGGAGCAGTGGGACTGC
GCCGCCATCGTTCTCGTCAGCCACTTCACCGCCGAGTTGCCGCAGATTTGGTTCTTCCACCCCATTGCCACCTTT
TTCGGCATGGACTACGGAGTGCCTTTTCCGCCGCTGTGGAAGATGGCCCTTCAGATTGCCATCCTCTTCGTCATG
GAAGACACCTGGCACTACTGGTTCCATCGATGCCTGCACTACGGCCCGCTTTACAAGGCCATCCACAAGATGCAC
CACACATACTCTGCGCCGTTTGGTCTGGCGGCCGAGTACGCGTCCCCCATCGAGACGATGCTGCTCGGCATGGGC
GTGGTTGGGTCACCGATCCTGATGCTCTGCGTCACGGGCGACCTGCATCTGATTACCATGTACACGTGGATCATT
CTTCGCTTGTTCCAGGCCATCGACGCTCACAGCGGCTACGACTTTCCCTGGAGCCTGCGTCACTTCCTTCCCGTC
TGGGCCGGCGCCGATCACCACGACATGCACCACGAGAAGTTTATGGGCAACTACGCCTCGAGCTTCCGCTGGTGG
GACTACTTTCTGGACACCGAGGCCGGCCCGGAGGCCCACAGGCGCCGGCGCGAGAAGAAGCTCAAGGCCATCAGG
GAAGCCAAGAAGCAGCAA
Transcript >Ophio5|7040
ATGGACGTCGTAAATGCCACAGCTAAAGCCCTGGGCAACCAGACCCAGGACTACTTTACCGTTCTCGATGAGGTC
TCCAAGACCAGTCTTCACCTCAACTTTGCCGAGCGTCTCTGGGCCGCTTGGTATCTTTTTATGCAGAATGACACC
CTCGCCACCGGCATCATGAGCTTCGTCATGCACGAGATTGTCTACTTTGGCCGCTGCCTTCCGTTCATCATCATG
GACAAGATCCCCTACTTCCAGCAGTACAAGATCCAGAACCAGAAGATGCCGACACTCAAGGAGCAGTGGGACTGC
GCCGCCATCGTTCTCGTCAGCCACTTCACCGCCGAGTTGCCGCAGATTTGGTTCTTCCACCCCATTGCCACCTTT
TTCGGCATGGACTACGGAGTGCCTTTTCCGCCGCTGTGGAAGATGGCCCTTCAGATTGCCATCCTCTTCGTCATG
GAAGACACCTGGCACTACTGGTTCCATCGATGCCTGCACTACGGCCCGCTTTACAAGGCCATCCACAAGATGCAC
CACACATACTCTGCGCCGTTTGGTCTGGCGGCCGAGTACGCGTCCCCCATCGAGACGATGCTGCTCGGCATGGGC
GTGGTTGGGTCACCGATCCTGATGCTCTGCGTCACGGGCGACCTGCATCTGATTACCATGTACACGTGGATCATT
CTTCGCTTGTTCCAGGCCATCGACGCTCACAGCGGCTACGACTTTCCCTGGAGCCTGCGTCACTTCCTTCCCGTC
TGGGCCGGCGCCGATCACCACGACATGCACCACGAGAAGTTTATGGGCAACTACGCCTCGAGCTTCCGCTGGTGG
GACTACTTTCTGGACACCGAGGCCGGCCCGGAGGCCCACAGGCGCCGGCGCGAGAAGAAGCTCAAGGCCATCAGG
GAAGCCAAGAAGCAGCAATAA
Gene >Ophio5|7040
ATGGACGTCGTGTGAGTCTAGCGACGCTGTGCCTCTCCTCTCTTCCTCGTTCTGACGTGGAGCATCGCAGAAATG
CCACAGCTAAAGCCCTGGGCAACCAGACCCAGGACTACTTTACCGTTCTCGATGAGGTCTCCAAGACCAGTCTTC
ACCTCAACTTTGCCGAGCGTCTCTGGGCCGTACGTCTTCTCCGGATGGTTGACTGTGGCCGACGTCTGACGCTTC
TATAGGCTTGGTATCTTTTTATGCAGAATGACACCCTCGCCACCGGCATCATGAGCTTCGTCATGCACGAGATTG
TCTACTTTGGCCGCTGCCTTCCGTTCATCATCATGGACAAGATCCCCTACTTCCAGCAGTACAAGATCCAGAACC
AGAAGATGCCGACACTCAAGGAGCAGTGGGACTGCGCCGCCATCGTTCTCGTCAGCCACTTCACCGCCGAGTTGC
CGCAGATTTGGTTCTTCCACCCCATTGCCACCTTTTTCGGCATGGACTACGGAGTGCCTTTTCCGCCGCTGTGGA
AGATGGCCCTTCAGATTGCCATCCTCTTCGTCATGGAAGACACCTGGCACTACTGGTTCCATCGATGCCTGCACT
ACGGCCCGCTTTACAAGGCCATCCACAAGATGCACCACACATACTCTGCGCCGTTTGGTCTGGCGGCCGAGTACG
CGTCCCCCATCGAGACGATGCTGCTCGGCATGGGCGTGGTTGGGTCACCGATCCTGATGCTCTGCGTCACGGGCG
ACCTGCATCTGATTACCATGTACACGTGGATCATTCTTCGCTTGTTCCAGGCCATCGACGCTCACAGCGGCTACG
ACTTTCCCTGGAGCCTGCGTCACTTCCTTCCCGTCTGGGCCGGCGCCGATCACCACGACATGCACCACGAGAAGT
TTATGGGCAACTACGCCTCGAGCTTCCGCTGGTGGGACTACTTTCTGGACACCGAGGCCGGCCCGGAGGCCCACA
GGCGCCGGCGCGAGAAGAAGCTCAAGGCCATCAGGGAAGCCAAGAAGCAGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail