Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7035
Gene name
Locationscaffold_65:36618..39295
Strand-
Gene length (bp)2677
Transcript length (bp)2259
Coding sequence length (bp)2256
Protein length (aa) 752

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04055 Radical_SAM Radical SAM superfamily 1.5E-23 412 592
PF08608 Wyosine_form Wyosine base formation 1.5E-23 597 665

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 20 731 0.0E+00
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 99 747 0.0E+00
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 79 735 1.0E-142
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 184 745 3.0E-142
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 310 735 4.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 20 731 0.0E+00
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 99 747 0.0E+00
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 79 735 1.0E-142
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 184 745 3.0E-142
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 310 735 4.0E-142
sp|Q8BJM7|TYW1_MOUSE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Mus musculus GN=Tyw1 PE=1 SV=1 68 735 6.0E-142
sp|Q5REF9|TYW1_PONAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pongo abelii GN=TYW1 PE=2 SV=1 142 735 1.0E-140
sp|Q9NV66|TYW1_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1 PE=2 SV=2 363 735 2.0E-140
sp|Q8H8N3|TYW1_ORYSJ S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Oryza sativa subsp. japonica GN=TYW1 PE=2 SV=1 184 730 1.0E-134
sp|Q6NUM6|TYW1B_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1B PE=2 SV=3 404 735 6.0E-110
sp|Q9V1F9|TYW1_PYRAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=taw1 PE=1 SV=1 366 664 3.0E-54
sp|O59412|TYW1_PYRHO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=taw1 PE=1 SV=1 366 664 7.0E-54
sp|Q57705|TYW1_METJA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=taw1 PE=1 SV=1 353 614 2.0E-41
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0051540 metal cluster binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.1561 0.3336 0.0552 0.1394 0.4296 0.0349 0.82 0.2036 0.3609 0.291

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 72.28 38.56 106.00
CcL In ants, during behavior modification 37.35 19.81 54.89
CcD In ants, recently dead 41.99 22.66 61.32

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.002047 yes
SC16a CcD 0.014981 yes
CcL CcD 0.662445 no

Orthologs

Orthofinder run ID4
Orthogroup4420
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5422
Ophiocordyceps australis map64 (Brazil) OphauB2|3883
Ophiocordyceps camponoti-floridani Ophcf2|04125
Ophiocordyceps camponoti-rufipedis Ophun1|4034
Ophiocordyceps kimflemingae Ophio5|7035 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9150

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7035
MEALGWHPYLLTIDDVVDLWHAHRTSLILGTVAVLVAIRLFLRRHDDDVELVALPDVYRDEAALSEKTNSGPRRI
KGGAVKKAAVKREADVVTAMPPVKLIVFFSSVTDTTTKLALDYRADLAAATDQLARETGRPFLIPEVYDLAEIDL
DDFFIAPPMSPAEAGLFYLFLIPSYNVDSINDTLLQHLRETHHDFRIDTAPLASLLGYSVFGYGDREGWPDEAQG
FCFQAIELDKCMSKLTGRKRAYPVGMGDVKRHHAQRFAEWAAGVRDVVVDVARTGHLGLGVRGSGNAVESDDDDG
GDDGQTLDQGVVLGDVEDLGNMVRAGGSTTKVKPPLAVDFTTYGQQMPVVKEMVPRGSPTYAALTKQGYSIVGTH
SGVKICRWTKSALRGRGSCYKYSLYGINSHQCMETTPSLSCSNKCVFCWRHGTNPVGTTWRWVVDPPDLILRGVK
EGHYSKIRMMRGVPGVRAERYAEALRIRHCALSLVGEPIFYPHIDEFLALLHAERISSFLVCNAQHPDQLAALKA
VTQLYVSIDASNRESLRKIDRPLHRDFWERFQRCLDILREKRFRHRTVFRLTLVKGFNVDEEVEGYARLVERGLP
CFVEVKGVTYCGTSTSANAGISMSNVPFYWEVCDFVRALNSRLADLGLGYGIAAEHAHSCCVLLASERFRVGGVW
HTHIDYDRFFDLLEERGPDGDWTPEDYMGAPTPEWALWGNGGFDPRDQRVDRKGRSMEVTVVRERPPEPEPGEGE
RT
Coding >Ophio5|7035
ATGGAGGCCCTGGGCTGGCATCCGTATTTGTTAACCATCGACGACGTCGTCGACCTCTGGCACGCCCATCGCACG
TCCCTCATCCTCGGCACTGTCGCTGTTCTCGTCGCTATACGACTGTTCCTGCGCCGTCACGATGACGACGTGGAG
CTCGTTGCGCTGCCTGACGTCTACCGCGACGAGGCTGCGCTGTCTGAAAAGACTAACAGCGGCCCACGGAGAATC
AAAGGCGGCGCCGTGAAGAAGGCGGCGGTCAAACGAGAAGCCGACGTCGTCACCGCGATGCCGCCTGTCAAGCTC
ATCGTCTTCTTTTCCTCTGTGACGGACACGACTACCAAGTTGGCGCTCGACTATCGGGCTGACTTGGCTGCGGCT
ACGGACCAGCTTGCGCGTGAGACGGGACGACCGTTTCTGATACCCGAGGTGTACGACCTTGCTGAGATAGACCTT
GACGATTTCTTCATTGCTCCGCCCATGTCTCCCGCTGAGGCCGGTCTATTCTACCTCTTCTTGATTCCGAGCTAC
AATGTCGATAGCATCAACGACACTCTCCTGCAACATCTGCGCGAGACGCACCACGACTTTCGTATCGACACGGCG
CCTCTCGCCTCGCTTCTGGGCTATTCTGTCTTTGGCTACGGCGACAGGGAGGGTTGGCCGGACGAGGCTCAGGGC
TTCTGCTTCCAGGCCATCGAGCTGGACAAGTGCATGTCCAAGCTGACGGGCCGCAAGCGCGCGTATCCCGTGGGA
ATGGGCGACGTGAAGAGGCATCATGCCCAGCGGTTCGCTGAGTGGGCTGCCGGTGTTCGGGACGTTGTCGTCGAT
GTCGCCCGGACGGGACACCTGGGTCTCGGCGTGCGCGGAAGCGGCAATGCCGTTGAGAGCGACGATGACGATGGT
GGCGATGACGGCCAAACGCTTGATCAAGGGGTGGTGCTGGGTGATGTCGAGGATCTGGGCAACATGGTCCGCGCG
GGCGGCAGCACGACAAAGGTCAAGCCGCCCCTGGCCGTCGATTTCACCACATATGGCCAGCAGATGCCCGTCGTC
AAAGAAATGGTTCCTCGCGGCTCACCCACGTACGCCGCTCTCACCAAACAGGGCTACTCCATCGTCGGCACACAC
TCGGGCGTCAAGATCTGCCGATGGACCAAGTCTGCGCTCCGTGGCCGCGGCAGCTGCTACAAGTACTCGCTCTAC
GGCATCAACTCGCACCAGTGCATGGAGACGACGCCTTCGCTCTCGTGCTCCAACAAGTGCGTCTTCTGCTGGCGG
CACGGCACCAACCCAGTCGGCACGACGTGGCGCTGGGTCGTCGATCCGCCTGACTTGATCCTCCGTGGCGTCAAG
GAGGGTCACTATAGCAAGATTCGCATGATGCGTGGCGTGCCAGGCGTGCGCGCTGAGCGGTACGCTGAGGCGTTA
CGCATTCGACACTGCGCGCTGTCGCTGGTCGGAGAGCCCATCTTTTACCCTCACATCGACGAGTTTCTCGCCCTG
CTGCACGCAGAGCGCATCTCGTCCTTCCTCGTCTGCAATGCCCAGCATCCCGATCAGCTGGCCGCTCTCAAGGCC
GTCACGCAGCTGTACGTGTCCATTGACGCGTCCAACCGCGAGTCTCTGCGCAAGATCGACAGGCCGCTCCACCGC
GACTTCTGGGAACGCTTCCAGCGGTGTCTGGACATCTTGCGCGAGAAGCGTTTCCGTCACCGCACCGTCTTTCGA
CTCACCCTCGTCAAGGGCTTCAACGTTGACGAGGAGGTCGAGGGATATGCCCGTCTGGTGGAACGCGGACTGCCC
TGCTTCGTCGAGGTCAAGGGCGTAACCTACTGCGGCACGTCGACGTCGGCCAATGCCGGCATATCCATGTCCAAC
GTGCCCTTTTACTGGGAGGTGTGCGACTTCGTCCGCGCCCTGAACTCTCGCCTCGCAGACCTGGGCTTGGGCTAC
GGCATCGCAGCCGAGCATGCTCACAGCTGCTGCGTTCTGCTCGCCAGTGAACGGTTCCGCGTCGGCGGCGTGTGG
CACACGCACATCGACTACGATCGTTTCTTTGACCTGCTCGAGGAAAGGGGGCCGGATGGGGATTGGACGCCCGAG
GATTACATGGGTGCGCCGACGCCCGAGTGGGCGCTGTGGGGGAACGGCGGCTTTGATCCTCGCGATCAGAGGGTA
GACCGCAAGGGGCGGAGCATGGAGGTGACGGTCGTTCGGGAGCGGCCACCGGAGCCGGAGCCGGGCGAGGGAGAG
AGGACG
Transcript >Ophio5|7035
ATGGAGGCCCTGGGCTGGCATCCGTATTTGTTAACCATCGACGACGTCGTCGACCTCTGGCACGCCCATCGCACG
TCCCTCATCCTCGGCACTGTCGCTGTTCTCGTCGCTATACGACTGTTCCTGCGCCGTCACGATGACGACGTGGAG
CTCGTTGCGCTGCCTGACGTCTACCGCGACGAGGCTGCGCTGTCTGAAAAGACTAACAGCGGCCCACGGAGAATC
AAAGGCGGCGCCGTGAAGAAGGCGGCGGTCAAACGAGAAGCCGACGTCGTCACCGCGATGCCGCCTGTCAAGCTC
ATCGTCTTCTTTTCCTCTGTGACGGACACGACTACCAAGTTGGCGCTCGACTATCGGGCTGACTTGGCTGCGGCT
ACGGACCAGCTTGCGCGTGAGACGGGACGACCGTTTCTGATACCCGAGGTGTACGACCTTGCTGAGATAGACCTT
GACGATTTCTTCATTGCTCCGCCCATGTCTCCCGCTGAGGCCGGTCTATTCTACCTCTTCTTGATTCCGAGCTAC
AATGTCGATAGCATCAACGACACTCTCCTGCAACATCTGCGCGAGACGCACCACGACTTTCGTATCGACACGGCG
CCTCTCGCCTCGCTTCTGGGCTATTCTGTCTTTGGCTACGGCGACAGGGAGGGTTGGCCGGACGAGGCTCAGGGC
TTCTGCTTCCAGGCCATCGAGCTGGACAAGTGCATGTCCAAGCTGACGGGCCGCAAGCGCGCGTATCCCGTGGGA
ATGGGCGACGTGAAGAGGCATCATGCCCAGCGGTTCGCTGAGTGGGCTGCCGGTGTTCGGGACGTTGTCGTCGAT
GTCGCCCGGACGGGACACCTGGGTCTCGGCGTGCGCGGAAGCGGCAATGCCGTTGAGAGCGACGATGACGATGGT
GGCGATGACGGCCAAACGCTTGATCAAGGGGTGGTGCTGGGTGATGTCGAGGATCTGGGCAACATGGTCCGCGCG
GGCGGCAGCACGACAAAGGTCAAGCCGCCCCTGGCCGTCGATTTCACCACATATGGCCAGCAGATGCCCGTCGTC
AAAGAAATGGTTCCTCGCGGCTCACCCACGTACGCCGCTCTCACCAAACAGGGCTACTCCATCGTCGGCACACAC
TCGGGCGTCAAGATCTGCCGATGGACCAAGTCTGCGCTCCGTGGCCGCGGCAGCTGCTACAAGTACTCGCTCTAC
GGCATCAACTCGCACCAGTGCATGGAGACGACGCCTTCGCTCTCGTGCTCCAACAAGTGCGTCTTCTGCTGGCGG
CACGGCACCAACCCAGTCGGCACGACGTGGCGCTGGGTCGTCGATCCGCCTGACTTGATCCTCCGTGGCGTCAAG
GAGGGTCACTATAGCAAGATTCGCATGATGCGTGGCGTGCCAGGCGTGCGCGCTGAGCGGTACGCTGAGGCGTTA
CGCATTCGACACTGCGCGCTGTCGCTGGTCGGAGAGCCCATCTTTTACCCTCACATCGACGAGTTTCTCGCCCTG
CTGCACGCAGAGCGCATCTCGTCCTTCCTCGTCTGCAATGCCCAGCATCCCGATCAGCTGGCCGCTCTCAAGGCC
GTCACGCAGCTGTACGTGTCCATTGACGCGTCCAACCGCGAGTCTCTGCGCAAGATCGACAGGCCGCTCCACCGC
GACTTCTGGGAACGCTTCCAGCGGTGTCTGGACATCTTGCGCGAGAAGCGTTTCCGTCACCGCACCGTCTTTCGA
CTCACCCTCGTCAAGGGCTTCAACGTTGACGAGGAGGTCGAGGGATATGCCCGTCTGGTGGAACGCGGACTGCCC
TGCTTCGTCGAGGTCAAGGGCGTAACCTACTGCGGCACGTCGACGTCGGCCAATGCCGGCATATCCATGTCCAAC
GTGCCCTTTTACTGGGAGGTGTGCGACTTCGTCCGCGCCCTGAACTCTCGCCTCGCAGACCTGGGCTTGGGCTAC
GGCATCGCAGCCGAGCATGCTCACAGCTGCTGCGTTCTGCTCGCCAGTGAACGGTTCCGCGTCGGCGGCGTGTGG
CACACGCACATCGACTACGATCGTTTCTTTGACCTGCTCGAGGAAAGGGGGCCGGATGGGGATTGGACGCCCGAG
GATTACATGGGTGCGCCGACGCCCGAGTGGGCGCTGTGGGGGAACGGCGGCTTTGATCCTCGCGATCAGAGGGTA
GACCGCAAGGGGCGGAGCATGGAGGTGACGGTCGTTCGGGAGCGGCCACCGGAGCCGGAGCCGGGCGAGGGAGAG
AGGACGTAG
Gene >Ophio5|7035
ATGGAGGCCCTGGGCTGGCATCCGTATTTGTTAACCATCGACGGTGCGGTGAGAACAAGGTGGAGGAGCTGGATT
GGATGGATGATGTATAGATAGGCACTCTAGTGAGCCTCTAGTATATAAATGGTTTCTATTCGAGTATAGTCGGGT
ATTTATTTATTAAGGGAAAGGCTTTAAGGGGGCAATTATCGTATATCCTCTTCTAGGATCTTCTCCTTCTCTTAG
TGGTTATATGTATATAAGCGATAATTCGGTGGGGGTGGTTATGGCCGCTTGCTTTTTTCGACGAGCAAAGCTAGA
CGGCAGATGCTCATAGATCCTCACCACGTCCGGCTCGCCTCAGCCAGACCGCCCGGAATGGAGGCCCTGGGCTGG
CATCCGTATTTGTTAACCATCGACGGTGCGCAGCCCCAACCCGTCTCCTCTCTCTCACCCGTCGGAGCTGACTCA
TGCGACGCCAGACGTCGTCGACCTCTGGCACGCCCATCGCACGTCCCTCATCCTCGGCACTGTCGCTGTTCTCGT
CGCTATACGACTGTTCCTGCGCCGTCACGATGACGACGTGGAGCTCGTTGCGCTGCCTGACGTCTACCGCGACGA
GGCTGCGCTGTCTGAAAAGACTAACAGCGGCCCACGGAGAATCAAAGGCGGCGCCGTGAAGAAGGCGGCGGTCAA
ACGAGAAGCCGACGTCGTCACCGCGATGCCGCCTGTCAAGCTCATCGTCTTCTTTTCCTCTGTGACGGACACGAC
TACCAAGTTGGCGCTCGACTATCGGGCTGACTTGGCTGCGGCTACGGACCAGCTTGCGCGTGAGACGGGACGACC
GTTTCTGATACCCGAGGTGTACGACCTTGCTGAGATAGACCTTGACGATTTCTTCATTGCTCCGCCCATGTCTCC
CGCTGAGGCCGGTCTATTCTACCTCTTCTTGATTCCGAGCTACAATGTCGATAGCATCAACGACACTCTCCTGCA
ACATCTGCGCGAGACGCACCACGACTTTCGTATCGACACGGCGCCTCTCGCCTCGCTTCTGGGCTATTCTGTCTT
TGGCTACGGCGACAGGGAGGGTTGGCCGGACGAGGCTCAGGGCTTCTGCTTCCAGGCCATCGAGCTGGACAAGTG
CATGTCCAAGCTGACGGGCCGCAAGCGCGCGTATCCCGTGGGAATGGGCGACGTGAAGAGGCATCATGCCCAGCG
GTTCGCTGAGTGGGCTGCCGGTGTTCGGGACGTTGTCGTCGATGTCGCCCGGACGGGACACCTGGGTCTCGGCGT
GCGCGGAAGCGGCAATGCCGTTGAGAGCGACGATGACGATGGTGGCGATGACGGCCAAACGCTTGATCAAGGGGT
GGTGCTGGGTGATGTCGAGGATCTGGGCAACATGGTCCGCGCGGGCGGCAGCACGACAAAGGTCAAGCCGCCCCT
GGCCGTCGATTTCACCACATATGGCCAGCAGATGCCCGTCGTCAAAGAAATGGTTCCTCGCGGCTCACCCACGTA
CGCCGCTCTCACCAAACAGGGCTACTCCATCGTCGGCACACACTCGGGCGTCAAGATCTGCCGATGGACCAAGTC
TGCGCTCCGTGGCCGCGGCAGCTGCTACAAGTACTCGCTCTACGGCATCAACTCGCACCAGTGCATGGAGACGAC
GCCTTCGCTCTCGTGCTCCAACAAGTGCGTCTTCTGCTGGCGGCACGGCACCAACCCAGTCGGCACGACGTGGCG
CTGGGTCGTCGATCCGCCTGACTTGATCCTCCGTGGCGTCAAGGAGGGTCACTATAGCAAGATTCGCATGATGCG
TGGCGTGCCAGGCGTGCGCGCTGAGCGGTACGCTGAGGCGTTACGCATTCGACACTGCGCGCTGTCGCTGGTCGG
AGAGCCCATCTTTTACCCTCACATCGACGAGTTTCTCGCCCTGCTGCACGCAGAGCGCATCTCGTCCTTCCTCGT
CTGCAATGCCCAGCATCCCGATCAGCTGGCCGCTCTCAAGGCCGTCACGCAGCTGTACGTGTCCATTGACGCGTC
CAACCGCGAGTCTCTGCGCAAGATCGACAGGCCGCTCCACCGCGACTTCTGGGAACGCTTCCAGCGGTGTCTGGA
CATCTTGCGCGAGAAGCGTTTCCGTCACCGCACCGTCTTTCGACTCACCCTCGTCAAGGGCTTCAACGTTGACGA
GGAGGTCGAGGGATATGCCCGTCTGGTGGAACGCGGACTGCCCTGCTTCGTCGAGGTCAAGGGCGTAACCTACTG
CGGCACGTCGACGTCGGCCAATGCCGGCATATCCATGTCCAACGTGCCCTTTTACTGGGAGGTGTGCGACTTCGT
CCGCGCCCTGAACTCTCGCCTCGCAGACCTGGGCTTGGGCTACGGCATCGCAGCCGAGCATGCTCACAGCTGCTG
CGTTCTGCTCGCCAGTGAACGGTTCCGCGTCGGCGGCGTGTGGCACACGCACATCGACTACGATCGTTTCTTTGA
CCTGCTCGAGGAAAGGGGGCCGGATGGGGATTGGACGCCCGAGGATTACATGGGTGCGCCGACGCCCGAGTGGGC
GCTGTGGGGGAACGGCGGCTTTGATCCTCGCGATCAGAGGGTAGACCGCAAGGGGCGGAGCATGGAGGTGACGGT
CGTTCGGGAGCGGCCACCGGAGCCGGAGCCGGGCGAGGGAGAGAGGACGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail