Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|703
Gene name
Locationscaffold_1190:439..2193
Strand-
Gene length (bp)1754
Transcript length (bp)1698
Coding sequence length (bp)1695
Protein length (aa) 565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-41 36 452
PF07690 MFS_1 Major Facilitator Superfamily 6.9E-09 310 501

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 28 509 5.0E-135
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 22 504 6.0E-131
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 27 515 8.0E-80
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 27 513 1.0E-76
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 70 487 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 28 509 5.0E-135
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 22 504 6.0E-131
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 27 515 8.0E-80
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 27 513 1.0E-76
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 70 487 2.0E-15
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 68 334 1.0E-13
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 68 394 3.0E-13
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 68 394 3.0E-13
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 8 492 1.0E-11
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 70 459 5.0E-11
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 1 266 2.0E-10
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 1 266 2.0E-10
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 70 468 6.0E-10
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 68 459 2.0E-09
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 68 459 1.0E-08
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 19 442 2.0E-08
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 19 442 2.0E-08
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 19 442 2.0E-08
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 72 306 3.0E-07
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 4 181 4.0E-07
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 23 171 6.0E-07
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 23 171 6.0E-07
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 179 456 7.0E-07
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 70 278 2.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 68 300 2.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 70 460 3.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 70 460 3.0E-06
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 4 457 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 68 87 19
3 99 121 22
4 159 181 22
5 188 210 22
6 236 258 22
7 270 292 22
8 307 329 22
9 342 364 22
10 374 396 22
11 403 425 22
12 435 457 22
13 478 500 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|703
MSDPEPSSTSAPEPARSWASQSMTPAREALLVFTACMAQFCTQAAFMATLVLLHPIGDSFHIKSRPRLAWLVAGY
SLAAGTLIIFCGRLGDIFGHGRMLVIGFGWFALWSSISGLSAYSTFELAIFARVMQGVGPAVTLPNALAVLGTAY
PPGHRKAMVFALFGAVAPVGAIFGGVFASLLARLWWPWAWWVLALWLLFLAALAALAVPLRDRDKTDDEKEKEKS
GRDIRGFKAFLYALDLPAAVVGVSALVLFNFAWTQAPVDGWGKPSVLVPLITGFGLFALFIFIEMKLSPSPLLPL
DVLSVEVGFVLAAVLCGWASFGVWTLYLVQTLQDARQLSPLMLTAYFSPVAIAGAAAAVFTGLMLGPLRLGPSTV
MMIALLAFTVGSLLTALAPVHQTYWAQIFVAVIVMPLGMDCSFPAATLIVSNAVARDHQGVGASLVSTVVNYGIA
LGVGFAGTVEMHVQGDPDTVDGRLRGFRGALFVAVGLAGLGLAVCLVFAARERLLRRGRGTVDGDEVALQEIQSC
EKEMRAADATDGSFASPGSYQDGGGGAKRDAAATKTAIFC
Coding >Ophio5|703
ATGTCCGATCCCGAGCCGTCGTCGACTTCGGCCCCGGAGCCGGCCCGGTCGTGGGCTTCGCAGTCGATGACGCCT
GCGAGAGAGGCGCTGCTCGTGTTTACCGCCTGCATGGCCCAATTCTGCACCCAGGCGGCGTTTATGGCTACCCTG
GTACTGCTTCATCCCATCGGCGATTCCTTCCACATCAAGAGTCGGCCAAGGCTTGCCTGGCTGGTGGCCGGCTAC
TCACTCGCAGCCGGTACCCTCATCATCTTCTGCGGCCGACTCGGAGACATATTCGGACACGGCCGTATGCTCGTC
ATAGGATTCGGCTGGTTCGCCCTCTGGTCATCCATCTCCGGCCTATCCGCCTATTCAACCTTTGAACTCGCCATC
TTCGCACGCGTCATGCAAGGCGTCGGTCCGGCCGTCACGTTACCGAATGCGTTGGCTGTGCTCGGAACTGCGTAT
CCGCCTGGCCATCGAAAGGCCATGGTCTTTGCGCTGTTTGGGGCCGTTGCCCCGGTGGGCGCCATCTTTGGTGGT
GTCTTTGCCTCCTTGTTGGCTAGGCTTTGGTGGCCTTGGGCTTGGTGGGTTTTGGCCCTTTGGTTGCTTTTCTTG
GCCGCCTTGGCCGCTTTGGCTGTGCCTCTGAGGGATCGTGATAAGACGGATGATGAGAAAGAGAAGGAGAAGAGT
GGGAGAGATATAAGAGGCTTCAAGGCTTTTCTCTATGCTCTCGATCTCCCCGCCGCTGTTGTGGGTGTTTCTGCT
CTTGTTCTCTTCAACTTTGCTTGGACTCAAGCTCCCGTTGACGGATGGGGGAAGCCATCTGTGCTGGTACCGCTG
ATAACCGGCTTCGGACTCTTTGCCCTTTTCATCTTCATCGAGATGAAGCTGAGTCCCTCTCCGCTTCTTCCGCTG
GATGTCCTCAGCGTCGAGGTCGGCTTCGTCCTCGCTGCCGTTCTCTGCGGCTGGGCAAGTTTCGGCGTCTGGACT
CTCTACCTCGTTCAGACGCTACAGGATGCTCGTCAGCTGTCTCCGCTCATGTTGACGGCGTACTTTAGCCCCGTG
GCTATTGCTGGTGCTGCCGCTGCCGTTTTCACCGGTTTGATGCTTGGTCCCTTACGACTTGGGCCTTCGACGGTC
ATGATGATTGCTCTCTTGGCTTTTACTGTGGGTTCCTTGCTGACCGCCCTCGCGCCCGTTCATCAGACGTACTGG
GCGCAGATCTTTGTTGCTGTTATTGTCATGCCGTTGGGGATGGATTGCTCTTTTCCCGCTGCCACGCTCATTGTT
TCCAATGCGGTGGCGAGGGACCATCAAGGCGTTGGGGCCAGCCTCGTCAGCACCGTCGTCAACTACGGTATTGCT
CTTGGTGTGGGCTTTGCTGGCACCGTTGAGATGCACGTTCAGGGTGACCCGGATACGGTCGACGGTAGACTTCGA
GGTTTTCGAGGTGCGCTCTTCGTTGCTGTTGGACTCGCTGGATTGGGTTTGGCCGTTTGTTTGGTGTTTGCTGCG
AGGGAACGTCTTCTGCGGCGAGGCCGTGGAACGGTTGACGGTGACGAGGTCGCGTTGCAGGAGATTCAATCCTGT
GAGAAAGAGATGCGTGCCGCTGATGCTACTGATGGATCTTTTGCGTCGCCGGGGAGCTACCAAGACGGAGGAGGA
GGGGCGAAGCGAGACGCTGCTGCGACCAAGACGGCCATATTTTGT
Transcript >Ophio5|703
ATGTCCGATCCCGAGCCGTCGTCGACTTCGGCCCCGGAGCCGGCCCGGTCGTGGGCTTCGCAGTCGATGACGCCT
GCGAGAGAGGCGCTGCTCGTGTTTACCGCCTGCATGGCCCAATTCTGCACCCAGGCGGCGTTTATGGCTACCCTG
GTACTGCTTCATCCCATCGGCGATTCCTTCCACATCAAGAGTCGGCCAAGGCTTGCCTGGCTGGTGGCCGGCTAC
TCACTCGCAGCCGGTACCCTCATCATCTTCTGCGGCCGACTCGGAGACATATTCGGACACGGCCGTATGCTCGTC
ATAGGATTCGGCTGGTTCGCCCTCTGGTCATCCATCTCCGGCCTATCCGCCTATTCAACCTTTGAACTCGCCATC
TTCGCACGCGTCATGCAAGGCGTCGGTCCGGCCGTCACGTTACCGAATGCGTTGGCTGTGCTCGGAACTGCGTAT
CCGCCTGGCCATCGAAAGGCCATGGTCTTTGCGCTGTTTGGGGCCGTTGCCCCGGTGGGCGCCATCTTTGGTGGT
GTCTTTGCCTCCTTGTTGGCTAGGCTTTGGTGGCCTTGGGCTTGGTGGGTTTTGGCCCTTTGGTTGCTTTTCTTG
GCCGCCTTGGCCGCTTTGGCTGTGCCTCTGAGGGATCGTGATAAGACGGATGATGAGAAAGAGAAGGAGAAGAGT
GGGAGAGATATAAGAGGCTTCAAGGCTTTTCTCTATGCTCTCGATCTCCCCGCCGCTGTTGTGGGTGTTTCTGCT
CTTGTTCTCTTCAACTTTGCTTGGACTCAAGCTCCCGTTGACGGATGGGGGAAGCCATCTGTGCTGGTACCGCTG
ATAACCGGCTTCGGACTCTTTGCCCTTTTCATCTTCATCGAGATGAAGCTGAGTCCCTCTCCGCTTCTTCCGCTG
GATGTCCTCAGCGTCGAGGTCGGCTTCGTCCTCGCTGCCGTTCTCTGCGGCTGGGCAAGTTTCGGCGTCTGGACT
CTCTACCTCGTTCAGACGCTACAGGATGCTCGTCAGCTGTCTCCGCTCATGTTGACGGCGTACTTTAGCCCCGTG
GCTATTGCTGGTGCTGCCGCTGCCGTTTTCACCGGTTTGATGCTTGGTCCCTTACGACTTGGGCCTTCGACGGTC
ATGATGATTGCTCTCTTGGCTTTTACTGTGGGTTCCTTGCTGACCGCCCTCGCGCCCGTTCATCAGACGTACTGG
GCGCAGATCTTTGTTGCTGTTATTGTCATGCCGTTGGGGATGGATTGCTCTTTTCCCGCTGCCACGCTCATTGTT
TCCAATGCGGTGGCGAGGGACCATCAAGGCGTTGGGGCCAGCCTCGTCAGCACCGTCGTCAACTACGGTATTGCT
CTTGGTGTGGGCTTTGCTGGCACCGTTGAGATGCACGTTCAGGGTGACCCGGATACGGTCGACGGTAGACTTCGA
GGTTTTCGAGGTGCGCTCTTCGTTGCTGTTGGACTCGCTGGATTGGGTTTGGCCGTTTGTTTGGTGTTTGCTGCG
AGGGAACGTCTTCTGCGGCGAGGCCGTGGAACGGTTGACGGTGACGAGGTCGCGTTGCAGGAGATTCAATCCTGT
GAGAAAGAGATGCGTGCCGCTGATGCTACTGATGGATCTTTTGCGTCGCCGGGGAGCTACCAAGACGGAGGAGGA
GGGGCGAAGCGAGACGCTGCTGCGACCAAGACGGCCATATTTTGTTGA
Gene >Ophio5|703
ATGTCCGATCCCGAGCCGTCGTCGACTTCGGCCCCGGAGCCGGCCCGGTCGTGGGCTTCGCAGTCGATGACGCCT
GCGAGAGAGGCGCTGCTCGTGTTTACCGCCTGCATGGCCCAATTCTGCACCCGTACGTTCATCATCTGAATACAA
GAGACGACGGAAATGGCTGACGGAATTCTCTAGAGGCGGCGTTTATGGCTACCCTGGTACTGCTTCATCCCATCG
GCGATTCCTTCCACATCAAGAGTCGGCCAAGGCTTGCCTGGCTGGTGGCCGGCTACTCACTCGCAGCCGGTACCC
TCATCATCTTCTGCGGCCGACTCGGAGACATATTCGGACACGGCCGTATGCTCGTCATAGGATTCGGCTGGTTCG
CCCTCTGGTCATCCATCTCCGGCCTATCCGCCTATTCAACCTTTGAACTCGCCATCTTCGCACGCGTCATGCAAG
GCGTCGGTCCGGCCGTCACGTTACCGAATGCGTTGGCTGTGCTCGGAACTGCGTATCCGCCTGGCCATCGAAAGG
CCATGGTCTTTGCGCTGTTTGGGGCCGTTGCCCCGGTGGGCGCCATCTTTGGTGGTGTCTTTGCCTCCTTGTTGG
CTAGGCTTTGGTGGCCTTGGGCTTGGTGGGTTTTGGCCCTTTGGTTGCTTTTCTTGGCCGCCTTGGCCGCTTTGG
CTGTGCCTCTGAGGGATCGTGATAAGACGGATGATGAGAAAGAGAAGGAGAAGAGTGGGAGAGATATAAGAGGCT
TCAAGGCTTTTCTCTATGCTCTCGATCTCCCCGCCGCTGTTGTGGGTGTTTCTGCTCTTGTTCTCTTCAACTTTG
CTTGGACTCAAGCTCCCGTTGACGGATGGGGGAAGCCATCTGTGCTGGTACCGCTGATAACCGGCTTCGGACTCT
TTGCCCTTTTCATCTTCATCGAGATGAAGCTGAGTCCCTCTCCGCTTCTTCCGCTGGATGTCCTCAGCGTCGAGG
TCGGCTTCGTCCTCGCTGCCGTTCTCTGCGGCTGGGCAAGTTTCGGCGTCTGGACTCTCTACCTCGTTCAGACGC
TACAGGATGCTCGTCAGCTGTCTCCGCTCATGTTGACGGCGTACTTTAGCCCCGTGGCTATTGCTGGTGCTGCCG
CTGCCGTTTTCACCGGTTTGATGCTTGGTCCCTTACGACTTGGGCCTTCGACGGTCATGATGATTGCTCTCTTGG
CTTTTACTGTGGGTTCCTTGCTGACCGCCCTCGCGCCCGTTCATCAGACGTACTGGGCGCAGATCTTTGTTGCTG
TTATTGTCATGCCGTTGGGGATGGATTGCTCTTTTCCCGCTGCCACGCTCATTGTTTCCAATGCGGTGGCGAGGG
ACCATCAAGGCGTTGGGGCCAGCCTCGTCAGCACCGTCGTCAACTACGGTATTGCTCTTGGTGTGGGCTTTGCTG
GCACCGTTGAGATGCACGTTCAGGGTGACCCGGATACGGTCGACGGTAGACTTCGAGGTTTTCGAGGTGCGCTCT
TCGTTGCTGTTGGACTCGCTGGATTGGGTTTGGCCGTTTGTTTGGTGTTTGCTGCGAGGGAACGTCTTCTGCGGC
GAGGCCGTGGAACGGTTGACGGTGACGAGGTCGCGTTGCAGGAGATTCAATCCTGTGAGAAAGAGATGCGTGCCG
CTGATGCTACTGATGGATCTTTTGCGTCGCCGGGGAGCTACCAAGACGGAGGAGGAGGGGCGAAGCGAGACGCTG
CTGCGACCAAGACGGCCATATTTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail