Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7028
Gene name
Locationscaffold_65:19955..21672
Strand-
Gene length (bp)1717
Transcript length (bp)1581
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03727 Hexokinase_2 Hexokinase 1.3E-47 247 514
PF00349 Hexokinase_1 Hexokinase 4.8E-40 16 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4U3Y2|HXK1_ASPFU Hexokinase-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hxkA PE=2 SV=1 71 458 8.0E-29
sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 SV=1 20 440 7.0E-26
sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 20 440 7.0E-26
sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 20 440 7.0E-26
sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens GN=HK2 PE=1 SV=2 15 444 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4U3Y2|HXK1_ASPFU Hexokinase-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hxkA PE=2 SV=1 71 458 8.0E-29
sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 SV=1 20 440 7.0E-26
sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 20 440 7.0E-26
sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 20 440 7.0E-26
sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens GN=HK2 PE=1 SV=2 15 444 7.0E-26
sp|P27926|HXK3_RAT Hexokinase-3 OS=Rattus norvegicus GN=Hk3 PE=2 SV=1 72 440 1.0E-25
sp|O08528|HXK2_MOUSE Hexokinase-2 OS=Mus musculus GN=Hk2 PE=1 SV=1 15 444 2.0E-25
sp|P27881|HXK2_RAT Hexokinase-2 OS=Rattus norvegicus GN=Hk2 PE=1 SV=1 15 444 2.0E-25
sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 SV=1 15 444 4.0E-25
sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 15 444 4.0E-25
sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 15 444 4.0E-25
sp|Q1W674|HXK2_PIG Hexokinase-2 OS=Sus scrofa GN=HK2 PE=2 SV=1 15 444 5.0E-25
sp|Q3TRM8|HXK3_MOUSE Hexokinase-3 OS=Mus musculus GN=Hk3 PE=1 SV=2 44 440 2.0E-24
sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens GN=HK2 PE=1 SV=2 20 440 5.0E-24
sp|P27881|HXK2_RAT Hexokinase-2 OS=Rattus norvegicus GN=Hk2 PE=1 SV=1 20 440 5.0E-23
sp|P83776|HXKB_CANAL Hexokinase-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HXK2 PE=1 SV=2 20 434 6.0E-23
sp|Q1W674|HXK2_PIG Hexokinase-2 OS=Sus scrofa GN=HK2 PE=2 SV=1 20 379 9.0E-23
sp|Q2TB90|HKDC1_HUMAN Putative hexokinase HKDC1 OS=Homo sapiens GN=HKDC1 PE=1 SV=3 1 347 9.0E-23
sp|P52790|HXK3_HUMAN Hexokinase-3 OS=Homo sapiens GN=HK3 PE=1 SV=2 71 440 1.0E-22
sp|O08528|HXK2_MOUSE Hexokinase-2 OS=Mus musculus GN=Hk2 PE=1 SV=1 20 440 3.0E-22
sp|P17710|HXK1_MOUSE Hexokinase-1 OS=Mus musculus GN=Hk1 PE=1 SV=3 15 436 5.0E-22
sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 15 436 6.0E-22
sp|Q9NFT7|HXK2_DROME Hexokinase type 2 OS=Drosophila melanogaster GN=Hex-t2 PE=2 SV=4 67 517 7.0E-22
sp|Q9SEK2|HXK1_TOBAC Hexokinase-1 OS=Nicotiana tabacum GN=HXK1 PE=2 SV=1 72 515 1.0E-21
sp|P33284|HXK_KLULA Hexokinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG5 PE=1 SV=3 72 380 1.0E-21
sp|Q91W97|HKDC1_MOUSE Putative hexokinase HKDC1 OS=Mus musculus GN=Hkdc1 PE=2 SV=1 15 440 1.0E-21
sp|P50521|HXK2_SCHPO Hexokinase-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hxk2 PE=2 SV=1 72 525 3.0E-21
sp|P80581|HXK_EMENI Hexokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hxkA PE=1 SV=2 72 517 3.0E-21
sp|Q09756|HXK1_SCHPO Hexokinase-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hxk1 PE=2 SV=1 71 524 3.0E-21
sp|P93834|HXK2_ARATH Hexokinase-2 OS=Arabidopsis thaliana GN=HXK2 PE=1 SV=1 72 515 3.0E-21
sp|Q5RC71|HXK1_PONAB Hexokinase-1 OS=Pongo abelii GN=HK1 PE=2 SV=1 15 436 4.0E-21
sp|Q9SQ76|HXK2_SOLTU Hexokinase-2 OS=Solanum tuberosum GN=HXK2 PE=2 SV=1 72 515 2.0E-20
sp|Q8LQ68|HXK6_ORYSJ Hexokinase-6 OS=Oryza sativa subsp. japonica GN=HXK6 PE=2 SV=1 71 515 3.0E-20
sp|Q2KNB9|HXK2_ORYSJ Hexokinase-2 OS=Oryza sativa subsp. japonica GN=HXK2 PE=2 SV=1 72 377 3.0E-20
sp|Q42525|HXK1_ARATH Hexokinase-1 OS=Arabidopsis thaliana GN=HXK1 PE=1 SV=2 72 515 4.0E-20
sp|P05708|HXK1_RAT Hexokinase-1 OS=Rattus norvegicus GN=Hk1 PE=1 SV=4 15 377 4.0E-20
sp|P50506|HXK_SCHOC Hexokinase OS=Schwanniomyces occidentalis GN=HXK PE=3 SV=1 67 434 7.0E-20
sp|P17709|HXKG_YEAST Glucokinase-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLK1 PE=1 SV=1 72 435 7.0E-20
sp|Q2KNB7|HXK9_ORYSJ Hexokinase-9 OS=Oryza sativa subsp. japonica GN=HXK9 PE=2 SV=1 72 515 9.0E-20
sp|P05708|HXK1_RAT Hexokinase-1 OS=Rattus norvegicus GN=Hk1 PE=1 SV=4 71 440 1.0E-19
sp|Q26609|HXK_SCHMA Hexokinase OS=Schistosoma mansoni PE=1 SV=2 15 519 3.0E-19
sp|P04807|HXKB_YEAST Hexokinase-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXK2 PE=1 SV=4 67 434 4.0E-19
sp|Q6CUZ3|HXKG_KLULA Glucokinase-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLK1 PE=1 SV=1 75 468 5.0E-19
sp|P17710|HXK1_MOUSE Hexokinase-1 OS=Mus musculus GN=Hk1 PE=1 SV=3 71 440 5.0E-19
sp|Q04409|EMI2_YEAST Putative glucokinase-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMI2 PE=1 SV=1 75 468 7.0E-19
sp|Q2TB90|HKDC1_HUMAN Putative hexokinase HKDC1 OS=Homo sapiens GN=HKDC1 PE=1 SV=3 71 440 2.0E-18
sp|Q91W97|HKDC1_MOUSE Putative hexokinase HKDC1 OS=Mus musculus GN=Hkdc1 PE=2 SV=1 71 440 2.0E-18
sp|Q59RW5|HXK1_CANAL N-acetylglucosamine kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HXK1 PE=1 SV=1 71 511 3.0E-18
sp|P04806|HXKA_YEAST Hexokinase-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXK1 PE=1 SV=2 72 434 3.0E-18
sp|Q5RC71|HXK1_PONAB Hexokinase-1 OS=Pongo abelii GN=HK1 PE=2 SV=1 71 440 1.0E-17
sp|P27595|HXK1_BOVIN Hexokinase-1 OS=Bos taurus GN=HK1 PE=2 SV=1 15 436 1.0E-17
sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 71 440 4.0E-17
sp|Q5W676|HXK5_ORYSJ Hexokinase-5 OS=Oryza sativa subsp. japonica GN=HXK5 PE=2 SV=1 67 393 8.0E-17
sp|Q6Z398|HXK4_ORYSJ Hexokinase-4, chloroplastic OS=Oryza sativa subsp. japonica GN=HXK4 PE=2 SV=1 67 504 8.0E-17
sp|Q6Q8A5|HXK2_TOBAC Hexokinase-2, chloroplastic OS=Nicotiana tabacum GN=HXK2 PE=2 SV=1 67 504 1.0E-16
sp|Q1WM16|HXK7_ORYSJ Hexokinase-7 OS=Oryza sativa subsp. japonica GN=HXK7 PE=2 SV=2 71 347 2.0E-16
sp|P17712|HXK4_RAT Glucokinase OS=Rattus norvegicus GN=Gck PE=1 SV=2 72 462 2.0E-16
sp|P35557|HXK4_HUMAN Glucokinase OS=Homo sapiens GN=GCK PE=1 SV=1 72 462 2.0E-16
sp|P27926|HXK3_RAT Hexokinase-3 OS=Rattus norvegicus GN=Hk3 PE=2 SV=1 67 436 3.0E-16
sp|Q9SEK3|HXK1_SPIOL Hexokinase-1 OS=Spinacia oleracea GN=HXK1 PE=2 SV=1 67 515 3.0E-16
sp|P52792|HXK4_MOUSE Glucokinase OS=Mus musculus GN=Gck PE=1 SV=1 72 444 5.0E-16
sp|Q92407|HXKG_ASPNG Glucokinase OS=Aspergillus niger GN=glkA PE=1 SV=1 72 435 6.0E-16
sp|P27595|HXK1_BOVIN Hexokinase-1 OS=Bos taurus GN=HK1 PE=2 SV=1 72 440 2.0E-15
sp|Q3TRM8|HXK3_MOUSE Hexokinase-3 OS=Mus musculus GN=Hk3 PE=1 SV=2 67 398 6.0E-15
sp|Q2KNB4|HXK3_ORYSJ Hexokinase-3 OS=Oryza sativa subsp. japonica GN=HXK3 PE=2 SV=1 71 383 1.0E-14
sp|Q1WM15|HXK8_ORYSJ Hexokinase-8 OS=Oryza sativa subsp. japonica GN=HXK8 PE=2 SV=2 72 347 2.0E-14
sp|O64390|HXK1_SOLTU Hexokinase-1 OS=Solanum tuberosum GN=HXK1 PE=1 SV=1 72 515 2.0E-14
sp|Q2KNB5|HXK10_ORYSJ Hexokinase-10 OS=Oryza sativa subsp. japonica GN=HXK10 PE=2 SV=1 71 383 2.0E-13
sp|P52790|HXK3_HUMAN Hexokinase-3 OS=Homo sapiens GN=HK3 PE=1 SV=2 136 389 6.0E-13
sp|Q9FZG4|HXKL1_ARATH Hexokinase-like 1 protein OS=Arabidopsis thaliana GN=At1g47840 PE=2 SV=2 71 380 3.0E-12
sp|Q8LH82|HXK1_ORYSJ Hexokinase-1 OS=Oryza sativa subsp. japonica GN=HXK1 PE=2 SV=1 71 347 2.0E-11
sp|Q56XE8|HXK4_ARATH Hexokinase-4 OS=Arabidopsis thaliana GN=At3g20040 PE=2 SV=2 72 377 8.0E-10
sp|Q9LPS1|HXK3_ARATH Hexokinase-3 OS=Arabidopsis thaliana GN=At1g50460 PE=1 SV=1 123 515 3.0E-08
sp|Q9T071|HXKL2_ARATH Probable hexokinase-like 2 protein OS=Arabidopsis thaliana GN=At4g37840 PE=3 SV=1 239 396 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0032555 purine ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7028
MASPSSSPSSSSPLSVDDFLRPLRLDATLRLDLCRRFVTNFSHLAAAASPDQFLPTPISESILRPVTTHGHGRHL
AIDIGGSNLRVGFVHLLATANGSHANGSANGHVNPPCRVRRLLERSWPIADHLKNDNADGLFRWIGSCIADVVEA
GCREFGLCRETPLPLGVSFSFPTEQHSLSEATITSMGKGFAVPADVELGARLCEGYEKFRVAANLPHVVVAAIAN
DSVSTLVSFIFNHGAVPHRRPAMGLILGTGTNATVPLRLTRLHPAKRHREVSVLPGESADDVKIAVNTEWSIRGT
EPPLRHLGLITPWDDLVSRQNEVPGFQPLEYMTAGRYLGELARIVLLAYMTEALGLSPEALPPALLQPHCLTTTF
LSHFRPPEPTSALVAKLRAAFPEKTGFAWTNDLAEALYRIAKSIELRAAAIMAAAIVALLTLAEELPPEGSSDGR
PNVREVGVGYTGGCIVHFLDYLADCQALVDDLVTARRGAGKTGPRVVLSPCHDGGITGAGILVAAALCSSGQKMG
A
Coding >Ophio5|7028
ATGGCGTCGCCGTCGTCGTCGCCGTCGTCGTCGTCGCCGCTGTCCGTAGACGACTTCCTCCGGCCGCTGCGGCTT
GACGCTACCTTGCGTCTTGATCTGTGTCGCCGCTTCGTCACAAACTTCTCCCATCTCGCTGCTGCCGCCTCACCT
GATCAGTTCCTGCCGACGCCGATATCCGAATCCATCCTGCGCCCGGTTACTACCCACGGCCACGGACGCCACCTC
GCCATAGACATCGGCGGCTCAAACCTCCGCGTCGGCTTCGTCCATCTTCTGGCCACCGCCAACGGCTCGCATGCC
AATGGCTCCGCAAACGGCCACGTCAACCCTCCCTGCCGCGTTCGCCGCCTCCTCGAACGGTCTTGGCCCATCGCC
GACCACCTCAAAAACGACAATGCCGACGGTCTCTTTCGCTGGATTGGCAGCTGCATCGCCGACGTCGTCGAGGCA
GGCTGTCGCGAGTTCGGCCTGTGCCGCGAGACGCCATTGCCTCTCGGCGTCTCCTTTAGCTTCCCGACGGAGCAA
CACTCGCTGTCCGAGGCCACCATCACCTCCATGGGCAAGGGCTTCGCCGTCCCGGCCGACGTCGAGCTGGGCGCC
CGCCTCTGCGAGGGCTACGAAAAGTTTCGCGTCGCCGCCAACCTCCCCCACGTCGTCGTTGCTGCCATCGCAAAC
GACTCCGTCTCGACGCTCGTCTCCTTCATCTTCAACCACGGCGCAGTGCCCCATCGCCGTCCCGCCATGGGCCTC
ATCCTCGGCACCGGCACCAACGCCACGGTGCCCCTGAGGTTGACGCGCCTGCACCCCGCCAAGCGCCACCGCGAG
GTGAGCGTGTTGCCGGGCGAGTCGGCCGACGACGTCAAGATTGCCGTCAACACCGAATGGAGCATCCGTGGCACC
GAACCGCCGCTGCGCCACCTGGGGCTCATTACCCCATGGGATGACCTCGTGAGCCGCCAGAACGAGGTGCCCGGA
TTCCAGCCCCTCGAATACATGACGGCAGGCCGCTACCTCGGCGAGCTGGCCCGCATCGTCCTGCTCGCCTACATG
ACGGAAGCCCTCGGCCTGTCTCCGGAGGCGCTGCCGCCGGCGCTACTGCAGCCGCACTGTCTGACAACGACGTTT
CTCAGCCACTTCCGTCCACCGGAGCCGACGTCGGCGCTCGTCGCCAAGCTCAGGGCCGCCTTTCCCGAGAAGACG
GGCTTCGCGTGGACCAACGACCTGGCCGAGGCCCTGTATCGCATCGCCAAGTCCATCGAGCTGCGCGCCGCCGCC
ATCATGGCAGCGGCCATCGTCGCCCTGCTGACGTTGGCTGAGGAGTTGCCGCCCGAGGGCTCGAGCGACGGCCGG
CCCAACGTACGCGAAGTCGGCGTCGGCTACACGGGCGGCTGCATCGTCCACTTCCTGGACTATCTGGCCGACTGC
CAGGCCTTGGTGGACGACCTGGTGACGGCGAGACGCGGGGCCGGCAAGACAGGTCCAAGGGTGGTGTTGAGCCCC
TGCCACGACGGGGGCATCACAGGAGCAGGCATTCTAGTGGCGGCGGCCCTCTGCAGCTCCGGCCAGAAGATGGGA
GCG
Transcript >Ophio5|7028
ATGGCGTCGCCGTCGTCGTCGCCGTCGTCGTCGTCGCCGCTGTCCGTAGACGACTTCCTCCGGCCGCTGCGGCTT
GACGCTACCTTGCGTCTTGATCTGTGTCGCCGCTTCGTCACAAACTTCTCCCATCTCGCTGCTGCCGCCTCACCT
GATCAGTTCCTGCCGACGCCGATATCCGAATCCATCCTGCGCCCGGTTACTACCCACGGCCACGGACGCCACCTC
GCCATAGACATCGGCGGCTCAAACCTCCGCGTCGGCTTCGTCCATCTTCTGGCCACCGCCAACGGCTCGCATGCC
AATGGCTCCGCAAACGGCCACGTCAACCCTCCCTGCCGCGTTCGCCGCCTCCTCGAACGGTCTTGGCCCATCGCC
GACCACCTCAAAAACGACAATGCCGACGGTCTCTTTCGCTGGATTGGCAGCTGCATCGCCGACGTCGTCGAGGCA
GGCTGTCGCGAGTTCGGCCTGTGCCGCGAGACGCCATTGCCTCTCGGCGTCTCCTTTAGCTTCCCGACGGAGCAA
CACTCGCTGTCCGAGGCCACCATCACCTCCATGGGCAAGGGCTTCGCCGTCCCGGCCGACGTCGAGCTGGGCGCC
CGCCTCTGCGAGGGCTACGAAAAGTTTCGCGTCGCCGCCAACCTCCCCCACGTCGTCGTTGCTGCCATCGCAAAC
GACTCCGTCTCGACGCTCGTCTCCTTCATCTTCAACCACGGCGCAGTGCCCCATCGCCGTCCCGCCATGGGCCTC
ATCCTCGGCACCGGCACCAACGCCACGGTGCCCCTGAGGTTGACGCGCCTGCACCCCGCCAAGCGCCACCGCGAG
GTGAGCGTGTTGCCGGGCGAGTCGGCCGACGACGTCAAGATTGCCGTCAACACCGAATGGAGCATCCGTGGCACC
GAACCGCCGCTGCGCCACCTGGGGCTCATTACCCCATGGGATGACCTCGTGAGCCGCCAGAACGAGGTGCCCGGA
TTCCAGCCCCTCGAATACATGACGGCAGGCCGCTACCTCGGCGAGCTGGCCCGCATCGTCCTGCTCGCCTACATG
ACGGAAGCCCTCGGCCTGTCTCCGGAGGCGCTGCCGCCGGCGCTACTGCAGCCGCACTGTCTGACAACGACGTTT
CTCAGCCACTTCCGTCCACCGGAGCCGACGTCGGCGCTCGTCGCCAAGCTCAGGGCCGCCTTTCCCGAGAAGACG
GGCTTCGCGTGGACCAACGACCTGGCCGAGGCCCTGTATCGCATCGCCAAGTCCATCGAGCTGCGCGCCGCCGCC
ATCATGGCAGCGGCCATCGTCGCCCTGCTGACGTTGGCTGAGGAGTTGCCGCCCGAGGGCTCGAGCGACGGCCGG
CCCAACGTACGCGAAGTCGGCGTCGGCTACACGGGCGGCTGCATCGTCCACTTCCTGGACTATCTGGCCGACTGC
CAGGCCTTGGTGGACGACCTGGTGACGGCGAGACGCGGGGCCGGCAAGACAGGTCCAAGGGTGGTGTTGAGCCCC
TGCCACGACGGGGGCATCACAGGAGCAGGCATTCTAGTGGCGGCGGCCCTCTGCAGCTCCGGCCAGAAGATGGGA
GCGTGA
Gene >Ophio5|7028
ATGGCGTCGCCGTCGTCGTCGCCGTCGTCGTCGTCGCCGCTGTCCGTAGACGACTTCCTCCGGCCGCTGCGGCTT
GACGCTACCTTGCGTCTTGATCTGTGTCGCCGCTTCGTCACAAACTTCTCCCATCTCGCTGCTGCCGCCTCACCT
GATCAGTTCCTGCCGACGCCGATATCCGAATCCATCCTGCGCCCGGTTACTACCCACGGCCACGGACGGTAAGCT
CGCTCTCCCCTGCCTTGAGTGTACTACAGAACTGACATGGGCTCGTCCAGCCACCTCGCCATAGACATGTGAGGA
CTCCTTTCCCGTCCCCTCCCCCCCTCCCCCCCTCCTGTCCCCTTCATCAGACGCTGAAGCCCATGCCAACAGCGG
CGGCTCAAACCTCCGCGTCGGCTTCGTCCATCTTCTGGCCACCGCCAACGGCTCGCATGCCAATGGCTCCGCAAA
CGGCCACGTCAACCCTCCCTGCCGCGTTCGCCGCCTCCTCGAACGGTCTTGGCCCATCGCCGACCACCTCAAAAA
CGACAATGCCGACGGTCTCTTTCGCTGGATTGGCAGCTGCATCGCCGACGTCGTCGAGGCAGGCTGTCGCGAGTT
CGGCCTGTGCCGCGAGACGCCATTGCCTCTCGGCGTCTCCTTTAGCTTCCCGACGGAGCAACACTCGCTGTCCGA
GGCCACCATCACCTCCATGGGCAAGGGCTTCGCCGTCCCGGCCGACGTCGAGCTGGGCGCCCGCCTCTGCGAGGG
CTACGAAAAGTTTCGCGTCGCCGCCAACCTCCCCCACGTCGTCGTTGCTGCCATCGCAAACGACTCCGTCTCGAC
GCTCGTCTCCTTCATCTTCAACCACGGCGCAGTGCCCCATCGCCGTCCCGCCATGGGCCTCATCCTCGGCACCGG
CACCAACGCCACGGTGCCCCTGAGGTTGACGCGCCTGCACCCCGCCAAGCGCCACCGCGAGGTGAGCGTGTTGCC
GGGCGAGTCGGCCGACGACGTCAAGATTGCCGTCAACACCGAATGGAGCATCCGTGGCACCGAACCGCCGCTGCG
CCACCTGGGGCTCATTACCCCATGGGATGACCTCGTGAGCCGCCAGAACGAGGTGCCCGGATTCCAGCCCCTCGA
ATACATGACGGCAGGCCGCTACCTCGGCGAGCTGGCCCGCATCGTCCTGCTCGCCTACATGACGGAAGCCCTCGG
CCTGTCTCCGGAGGCGCTGCCGCCGGCGCTACTGCAGCCGCACTGTCTGACAACGACGTTTCTCAGCCACTTCCG
TCCACCGGAGCCGACGTCGGCGCTCGTCGCCAAGCTCAGGGCCGCCTTTCCCGAGAAGACGGGCTTCGCGTGGAC
CAACGACCTGGCCGAGGCCCTGTATCGCATCGCCAAGTCCATCGAGCTGCGCGCCGCCGCCATCATGGCAGCGGC
CATCGTCGCCCTGCTGACGTTGGCTGAGGAGTTGCCGCCCGAGGGCTCGAGCGACGGCCGGCCCAACGTACGCGA
AGTCGGCGTCGGCTACACGGGCGGCTGCATCGTCCACTTCCTGGACTATCTGGCCGACTGCCAGGCCTTGGTGGA
CGACCTGGTGACGGCGAGACGCGGGGCCGGCAAGACAGGTCCAAGGGTGGTGTTGAGCCCCTGCCACGACGGGGG
CATCACAGGAGCAGGCATTCTAGTGGCGGCGGCCCTCTGCAGCTCCGGCCAGAAGATGGGAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail