Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7026
Gene name
Locationscaffold_65:16599..17916
Strand-
Gene length (bp)1317
Transcript length (bp)1110
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.1E-09 2 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 2 369 3.0E-33
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 1 341 1.0E-25
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 2 366 1.0E-22
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 2 342 6.0E-20
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 1 292 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 2 369 3.0E-33
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 1 341 1.0E-25
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 2 366 1.0E-22
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 2 342 6.0E-20
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 1 292 7.0E-17
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 2 354 1.0E-16
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 1 301 1.0E-16
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 1 354 1.0E-15
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 1 354 1.0E-15
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 4 369 3.0E-14
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 4 301 1.0E-08
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 7 293 3.0E-06
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 7 293 3.0E-06
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 60 337 3.0E-06
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 5 311 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 31 53 22
3 73 95 22
4 99 118 19
5 139 161 22
6 176 195 19
7 202 221 19
8 231 253 22
9 274 296 22
10 336 358 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7026
MNVIYGVGSALGAALGGAMAEALGWRWEFGVQVPPMLLCLAISAAVIPRGLGVAEEGVGVWRALRSFDTRGSLLL
TACVSFLILGLNLGGNVLAWSHPFVVTSLVIFAVCLPVFILVETRAPKPIMPLRLMGFAPRANLIYANFLAAILY
NAVIFNIPLYFQAVLLSSATSSGLRLVIPSMVASVAGTGVGFAVTWTRRLKWPVLWGTLSYLVGCICLFLLRREL
PPAVYLAALVPGAIGQGLQFPGTFMAVLACSAQSEQAVVTSTLILWRSLGLVLGVASSSLVVQNALVYYLARYVR
GPDAADVMDGVRASVEAVALLRQPYRDQVIRSYEAALALAFACCIALAAVSVALIAPVKLPRLRVGKKR
Coding >Ophio5|7026
ATGAACGTCATCTACGGTGTCGGCTCCGCCCTCGGTGCCGCGCTGGGAGGCGCCATGGCCGAGGCGCTCGGCTGG
CGATGGGAGTTTGGCGTTCAGGTGCCGCCCATGCTGCTGTGCCTGGCCATCTCGGCCGCCGTGATCCCTCGTGGG
CTGGGCGTGGCCGAGGAGGGCGTGGGCGTGTGGCGGGCGCTGCGGTCGTTTGATACTCGGGGCTCGTTACTACTG
ACGGCCTGTGTCTCCTTTCTTATCCTCGGTTTGAATCTGGGTGGGAATGTGCTTGCTTGGTCGCACCCGTTCGTC
GTGACGTCGCTCGTCATCTTCGCCGTCTGCTTACCCGTCTTCATCCTTGTCGAGACTCGGGCACCGAAGCCGATT
ATGCCGTTGCGTCTGATGGGCTTTGCGCCGAGGGCGAATCTCATCTATGCCAACTTCCTGGCTGCTATCTTGTAC
AACGCCGTCATCTTCAACATCCCCCTCTACTTCCAGGCCGTCCTCCTCTCCAGCGCCACCTCATCCGGCCTCCGG
CTCGTCATCCCTTCCATGGTCGCGTCCGTGGCCGGCACCGGCGTCGGCTTCGCCGTCACCTGGACCCGTCGCCTC
AAGTGGCCCGTCCTCTGGGGCACGCTGTCGTACCTCGTCGGCTGCATCTGCCTCTTCCTCCTCCGGCGAGAGCTC
CCTCCGGCCGTCTACCTGGCCGCCCTGGTTCCCGGAGCGATCGGGCAGGGCCTCCAGTTCCCGGGTACGTTTATG
GCCGTGCTCGCCTGCTCGGCCCAGTCGGAGCAGGCGGTCGTCACGTCCACCCTCATCCTCTGGCGCAGCCTCGGC
CTCGTCCTCGGCGTCGCCTCTAGCAGTCTCGTGGTCCAGAACGCTCTCGTCTACTACCTCGCTCGCTACGTTCGT
GGGCCGGACGCCGCCGACGTGATGGATGGCGTGAGGGCTTCCGTCGAGGCCGTGGCGTTGCTGAGGCAGCCTTAT
CGCGACCAGGTCATTCGTAGCTATGAGGCTGCTCTGGCCTTGGCTTTTGCCTGCTGTATTGCCTTGGCTGCCGTG
TCTGTCGCCCTCATTGCGCCGGTGAAGCTGCCGCGGCTGAGAGTTGGGAAGAAGCGC
Transcript >Ophio5|7026
ATGAACGTCATCTACGGTGTCGGCTCCGCCCTCGGTGCCGCGCTGGGAGGCGCCATGGCCGAGGCGCTCGGCTGG
CGATGGGAGTTTGGCGTTCAGGTGCCGCCCATGCTGCTGTGCCTGGCCATCTCGGCCGCCGTGATCCCTCGTGGG
CTGGGCGTGGCCGAGGAGGGCGTGGGCGTGTGGCGGGCGCTGCGGTCGTTTGATACTCGGGGCTCGTTACTACTG
ACGGCCTGTGTCTCCTTTCTTATCCTCGGTTTGAATCTGGGTGGGAATGTGCTTGCTTGGTCGCACCCGTTCGTC
GTGACGTCGCTCGTCATCTTCGCCGTCTGCTTACCCGTCTTCATCCTTGTCGAGACTCGGGCACCGAAGCCGATT
ATGCCGTTGCGTCTGATGGGCTTTGCGCCGAGGGCGAATCTCATCTATGCCAACTTCCTGGCTGCTATCTTGTAC
AACGCCGTCATCTTCAACATCCCCCTCTACTTCCAGGCCGTCCTCCTCTCCAGCGCCACCTCATCCGGCCTCCGG
CTCGTCATCCCTTCCATGGTCGCGTCCGTGGCCGGCACCGGCGTCGGCTTCGCCGTCACCTGGACCCGTCGCCTC
AAGTGGCCCGTCCTCTGGGGCACGCTGTCGTACCTCGTCGGCTGCATCTGCCTCTTCCTCCTCCGGCGAGAGCTC
CCTCCGGCCGTCTACCTGGCCGCCCTGGTTCCCGGAGCGATCGGGCAGGGCCTCCAGTTCCCGGGTACGTTTATG
GCCGTGCTCGCCTGCTCGGCCCAGTCGGAGCAGGCGGTCGTCACGTCCACCCTCATCCTCTGGCGCAGCCTCGGC
CTCGTCCTCGGCGTCGCCTCTAGCAGTCTCGTGGTCCAGAACGCTCTCGTCTACTACCTCGCTCGCTACGTTCGT
GGGCCGGACGCCGCCGACGTGATGGATGGCGTGAGGGCTTCCGTCGAGGCCGTGGCGTTGCTGAGGCAGCCTTAT
CGCGACCAGGTCATTCGTAGCTATGAGGCTGCTCTGGCCTTGGCTTTTGCCTGCTGTATTGCCTTGGCTGCCGTG
TCTGTCGCCCTCATTGCGCCGGTGAAGCTGCCGCGGCTGAGAGTTGGGAAGAAGCGCTAG
Gene >Ophio5|7026
ATGAACGTCATCTACGGTGTCGGCTCCGCCCTCGGTGCCGCGCTGGGAGGCGCCATGGCCGAGGCGCTCGGCTGG
CGATGGGAGTTTGGCGTTCAGGTGCCGCCCATGCTGCTGTGCCTGGCCATCTCGGCCGCCGTGATCCCTCGTGGG
CTGGGCGTGGCCGAGGAGGGCGTGGGCGTGTGGCGGGCGCTGCGGTCGTTTGATACTCGGGGCTCGTTACTACTG
ACGGCCTGTGTCTCCTTTCTTATCCTCGGTTTGGTGAGCTCTCTTTTGGTTTGGGGCCTGTGTGTGTGTGTGGTT
CGTTGCTGATGGTGTGTGTGATAGAATCTGGGTGGGAATGTGCTTGCTTGTGAGTTCTGGTCTGGCCAGTGTTTC
GAGAGGATGAAAAAGCTGTTGACTCGGGTCCCCGTATGCCAATAGGGTCGCACCCGTTCGTCGTGACGTCGCTCG
TCATCTTCGCCGTCTGCTTACCCGTCTTCATCCTTGTCGAGACTCGGGCACCGAAGCCGATTATGCCGTTGCGTC
TGATGGGCTTTGCGCCGAGGGCGAATCTCATCTATGCCAACTTCCTGGCTGCTATCTTGTACAACGCCGTCATCT
TCAACATGTGAGTGAGTCGGCTTCTGTTTTTTTTTTCTTCCTGTACCGCAACGCCAACACAACTGTATATACGAC
AGCCCCCTCTACTTCCAGGCCGTCCTCCTCTCCAGCGCCACCTCATCCGGCCTCCGGCTCGTCATCCCTTCCATG
GTCGCGTCCGTGGCCGGCACCGGCGTCGGCTTCGCCGTCACCTGGACCCGTCGCCTCAAGTGGCCCGTCCTCTGG
GGCACGCTGTCGTACCTCGTCGGCTGCATCTGCCTCTTCCTCCTCCGGCGAGAGCTCCCTCCGGCCGTCTACCTG
GCCGCCCTGGTTCCCGGAGCGATCGGGCAGGGCCTCCAGTTCCCGGGTACGTTTATGGCCGTGCTCGCCTGCTCG
GCCCAGTCGGAGCAGGCGGTCGTCACGTCCACCCTCATCCTCTGGCGCAGCCTCGGCCTCGTCCTCGGCGTCGCC
TCTAGCAGTCTCGTGGTCCAGAACGCTCTCGTCTACTACCTCGCTCGCTACGTTCGTGGGCCGGACGCCGCCGAC
GTGATGGATGGCGTGAGGGCTTCCGTCGAGGCCGTGGCGTTGCTGAGGCAGCCTTATCGCGACCAGGTCATTCGT
AGCTATGAGGCTGCTCTGGCCTTGGCTTTTGCCTGCTGTATTGCCTTGGCTGCCGTGTCTGTCGCCCTCATTGCG
CCGGTGAAGCTGCCGCGGCTGAGAGTTGGGAAGAAGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail