Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7024
Gene name
Locationscaffold_65:10703..13099
Strand-
Gene length (bp)2396
Transcript length (bp)2112
Coding sequence length (bp)2109
Protein length (aa) 703

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.5E-18 246 516
PF07690 MFS_1 Major Facilitator Superfamily 3.6E-11 551 675

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46996|YJQ3_YEAST Uncharacterized membrane protein YJL163C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL163C PE=1 SV=1 144 659 2.0E-24
sp|O13714|YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.07 PE=1 SV=1 200 521 4.0E-15
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 255 411 7.0E-07
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 238 369 2.0E-06
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 267 408 5.0E-06

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 188 207 19
2 248 270 22
3 282 301 19
4 311 333 22
5 346 368 22
6 378 400 22
7 463 485 22
8 500 522 22
9 576 598 22
10 613 635 22
11 642 661 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7024
MDSTDTGPRPRPKCASSMCWLQAVKTLQRSTAAAATNNGRGTLSHPALPVDARSRARSYQTFLGHVLDGVWRALI
CHQQPLAHRRFSLSLSLFCSLLQPFFTSTAWRHVWLNRLRSSSPVSRQMTSSKKPLDAVQPRDHGPDYEEVESGV
ETTVTTRLLGAGDETSDSGRWTGFDDFEGLPWWRKPSVLWLLGPFSLFTLAFGGTLVPKLNLVLDLVCRRYYADK
STTTLAVGGDNPMCRAPEVQRDVATFLLVINLVTGGLSAVVAPKLGHLSDRYGRRRLLALASCGGLLGELITVLA
AKFPETVDYRWLVLGALFDGMTGSFTAGSILSQSYTSDCTPPSRRAVSIGYIQACLFMGLAFGPLLSGYFVKWTG
SLVSMFYVAIGCHAFFVLFAGFVIPESLSEKRQLAARVKWQRAQEARTTGVGSLLSVVKKSNPFAPLQMLWPTGQ
GTSTRLRLNLLTLAICDAIFLGAAFAVGPVLMLYAEFMFQWGNFETSRFVSILSLTRVVILMGLLPLINYVGRVR
PAVRRQKRLGTVPVEKNAGADGLDIWILRIALVCEVLGCLGYTLARDQGPFVASGMMTAFGGLGSATTQAAVTKH
VPPERVGQMLGAIGMLHALSRVVGPVIFSGLYAGTVKTFPQAVFLALGSLFAFALVATLAIKPHVHWHEALEEQS
EPRRRTPQRLYSTIVETLPIDEDQVRLQ
Coding >Ophio5|7024
ATGGATAGCACGGATACAGGGCCGCGACCACGTCCAAAGTGCGCGTCATCGATGTGCTGGCTTCAGGCCGTTAAG
ACGTTGCAGCGGTCGACAGCTGCTGCCGCAACCAACAACGGTCGAGGCACGCTTAGTCATCCGGCTCTTCCCGTC
GATGCTCGCTCTCGGGCACGGAGTTATCAGACATTCCTTGGCCATGTTCTTGATGGAGTGTGGCGTGCCCTTATC
TGCCACCAACAGCCTCTTGCGCATCGTCGCTTTTCTCTCTCTCTCTCCCTATTCTGTTCTTTGCTCCAGCCTTTC
TTTACCTCTACCGCCTGGCGACATGTGTGGCTGAATCGTCTGCGAAGCTCAAGCCCTGTGTCACGACAGATGACA
TCTTCCAAGAAGCCGCTCGACGCGGTGCAACCTCGCGACCACGGGCCCGACTATGAAGAAGTTGAGTCCGGAGTC
GAGACCACGGTCACGACGCGGCTGCTCGGTGCCGGCGATGAGACTTCCGACAGCGGCCGCTGGACCGGCTTCGAC
GATTTCGAGGGCCTGCCTTGGTGGCGCAAGCCTTCGGTCCTGTGGCTGCTCGGCCCCTTTTCGCTCTTCACCCTC
GCCTTTGGCGGCACCCTGGTTCCCAAACTGAACCTGGTTCTGGACCTCGTCTGTCGACGGTATTACGCCGACAAG
AGTACCACCACCCTGGCCGTCGGCGGCGACAATCCCATGTGTAGGGCGCCCGAGGTGCAAAGAGACGTGGCCACC
TTTTTGCTCGTCATCAACCTCGTCACCGGCGGCTTGAGCGCTGTCGTCGCTCCCAAGCTAGGCCACTTGTCCGAC
CGCTATGGCAGGCGGCGGCTGTTGGCCTTGGCGTCGTGTGGCGGCCTGCTGGGCGAGCTCATCACCGTTCTGGCC
GCCAAGTTTCCCGAGACGGTCGACTATCGCTGGCTAGTTCTCGGGGCCTTGTTTGACGGCATGACAGGCTCCTTC
ACCGCTGGCAGCATTCTGAGCCAGTCATACACGAGCGACTGCACGCCCCCGTCCAGGCGAGCCGTTTCCATCGGC
TACATCCAGGCATGCCTTTTCATGGGCCTGGCTTTTGGTCCCCTTTTGTCCGGCTACTTTGTCAAGTGGACTGGC
AGTCTCGTGTCCATGTTCTATGTCGCCATCGGCTGCCACGCCTTCTTCGTCCTCTTCGCCGGCTTCGTCATACCC
GAGTCTTTGTCGGAAAAGAGGCAGCTCGCGGCCCGGGTCAAGTGGCAGCGGGCCCAGGAGGCTCGAACCACGGGC
GTCGGCTCCCTGCTGTCTGTCGTCAAAAAGTCCAACCCGTTTGCTCCTCTGCAGATGTTGTGGCCTACCGGTCAG
GGAACGTCGACGCGACTGCGCCTCAACCTGTTGACACTGGCTATCTGTGACGCCATCTTCCTCGGAGCCGCCTTT
GCCGTCGGGCCCGTCCTCATGTTGTACGCCGAATTCATGTTCCAATGGGGCAACTTCGAGACGTCACGCTTCGTC
TCTATCCTGTCCCTGACTCGTGTCGTCATCCTCATGGGACTCCTACCGCTCATCAACTATGTGGGACGTGTGCGG
CCCGCGGTCCGGCGGCAGAAACGACTCGGCACGGTACCAGTGGAGAAAAACGCCGGAGCGGATGGGCTCGACATC
TGGATACTCCGCATCGCCCTGGTCTGCGAGGTGCTTGGCTGTCTGGGCTACACCCTAGCTCGCGACCAGGGCCCA
TTCGTGGCCAGCGGCATGATGACGGCCTTTGGCGGGCTTGGGAGCGCCACGACGCAGGCCGCCGTGACCAAACAC
GTGCCGCCGGAGCGGGTGGGCCAGATGCTCGGCGCTATCGGCATGCTGCACGCTCTGTCGAGGGTTGTCGGCCCC
GTCATCTTCAGCGGCCTGTACGCCGGAACGGTGAAGACATTTCCGCAGGCCGTCTTCCTTGCCCTCGGCAGCTTG
TTTGCCTTTGCTCTCGTCGCCACTCTAGCTATTAAGCCGCACGTCCACTGGCACGAAGCTCTCGAGGAGCAAAGC
GAGCCGCGACGGCGTACGCCGCAACGGCTGTACAGCACCATAGTCGAAACGCTGCCCATCGACGAGGACCAAGTG
CGCTTACAG
Transcript >Ophio5|7024
ATGGATAGCACGGATACAGGGCCGCGACCACGTCCAAAGTGCGCGTCATCGATGTGCTGGCTTCAGGCCGTTAAG
ACGTTGCAGCGGTCGACAGCTGCTGCCGCAACCAACAACGGTCGAGGCACGCTTAGTCATCCGGCTCTTCCCGTC
GATGCTCGCTCTCGGGCACGGAGTTATCAGACATTCCTTGGCCATGTTCTTGATGGAGTGTGGCGTGCCCTTATC
TGCCACCAACAGCCTCTTGCGCATCGTCGCTTTTCTCTCTCTCTCTCCCTATTCTGTTCTTTGCTCCAGCCTTTC
TTTACCTCTACCGCCTGGCGACATGTGTGGCTGAATCGTCTGCGAAGCTCAAGCCCTGTGTCACGACAGATGACA
TCTTCCAAGAAGCCGCTCGACGCGGTGCAACCTCGCGACCACGGGCCCGACTATGAAGAAGTTGAGTCCGGAGTC
GAGACCACGGTCACGACGCGGCTGCTCGGTGCCGGCGATGAGACTTCCGACAGCGGCCGCTGGACCGGCTTCGAC
GATTTCGAGGGCCTGCCTTGGTGGCGCAAGCCTTCGGTCCTGTGGCTGCTCGGCCCCTTTTCGCTCTTCACCCTC
GCCTTTGGCGGCACCCTGGTTCCCAAACTGAACCTGGTTCTGGACCTCGTCTGTCGACGGTATTACGCCGACAAG
AGTACCACCACCCTGGCCGTCGGCGGCGACAATCCCATGTGTAGGGCGCCCGAGGTGCAAAGAGACGTGGCCACC
TTTTTGCTCGTCATCAACCTCGTCACCGGCGGCTTGAGCGCTGTCGTCGCTCCCAAGCTAGGCCACTTGTCCGAC
CGCTATGGCAGGCGGCGGCTGTTGGCCTTGGCGTCGTGTGGCGGCCTGCTGGGCGAGCTCATCACCGTTCTGGCC
GCCAAGTTTCCCGAGACGGTCGACTATCGCTGGCTAGTTCTCGGGGCCTTGTTTGACGGCATGACAGGCTCCTTC
ACCGCTGGCAGCATTCTGAGCCAGTCATACACGAGCGACTGCACGCCCCCGTCCAGGCGAGCCGTTTCCATCGGC
TACATCCAGGCATGCCTTTTCATGGGCCTGGCTTTTGGTCCCCTTTTGTCCGGCTACTTTGTCAAGTGGACTGGC
AGTCTCGTGTCCATGTTCTATGTCGCCATCGGCTGCCACGCCTTCTTCGTCCTCTTCGCCGGCTTCGTCATACCC
GAGTCTTTGTCGGAAAAGAGGCAGCTCGCGGCCCGGGTCAAGTGGCAGCGGGCCCAGGAGGCTCGAACCACGGGC
GTCGGCTCCCTGCTGTCTGTCGTCAAAAAGTCCAACCCGTTTGCTCCTCTGCAGATGTTGTGGCCTACCGGTCAG
GGAACGTCGACGCGACTGCGCCTCAACCTGTTGACACTGGCTATCTGTGACGCCATCTTCCTCGGAGCCGCCTTT
GCCGTCGGGCCCGTCCTCATGTTGTACGCCGAATTCATGTTCCAATGGGGCAACTTCGAGACGTCACGCTTCGTC
TCTATCCTGTCCCTGACTCGTGTCGTCATCCTCATGGGACTCCTACCGCTCATCAACTATGTGGGACGTGTGCGG
CCCGCGGTCCGGCGGCAGAAACGACTCGGCACGGTACCAGTGGAGAAAAACGCCGGAGCGGATGGGCTCGACATC
TGGATACTCCGCATCGCCCTGGTCTGCGAGGTGCTTGGCTGTCTGGGCTACACCCTAGCTCGCGACCAGGGCCCA
TTCGTGGCCAGCGGCATGATGACGGCCTTTGGCGGGCTTGGGAGCGCCACGACGCAGGCCGCCGTGACCAAACAC
GTGCCGCCGGAGCGGGTGGGCCAGATGCTCGGCGCTATCGGCATGCTGCACGCTCTGTCGAGGGTTGTCGGCCCC
GTCATCTTCAGCGGCCTGTACGCCGGAACGGTGAAGACATTTCCGCAGGCCGTCTTCCTTGCCCTCGGCAGCTTG
TTTGCCTTTGCTCTCGTCGCCACTCTAGCTATTAAGCCGCACGTCCACTGGCACGAAGCTCTCGAGGAGCAAAGC
GAGCCGCGACGGCGTACGCCGCAACGGCTGTACAGCACCATAGTCGAAACGCTGCCCATCGACGAGGACCAAGTG
CGCTTACAGTGA
Gene >Ophio5|7024
ATGGATAGCACGGATACAGGGTGCGAATGCAGGGTGTGAATACAGGTTTACTGCTAAATGTTTACCAGGCCGCGA
CCACGTCCAAAGTGCGCGTCATCGATGTGCTGGCTTCAGGCCGTTAAGACGTTGCAGCGGTCGACAGCTGCTGCC
GCAACCAACAACGGTCGAGGCACGCTTAGTCATCCGGTGAGATGTCCGTGTCCGTGCCACTCCCTGCCTACTTCA
GCTCAGCACTAGGCTCTTCCCGTCGATGCTCGCTCTCGGGCACGGAGTTATCAGACATTCCTTGGCCATGTTCTT
GATGGAGTGTGGCGTGCCCTTATCTGCCACCAACAGCCTCTTGCGCATCGTCGCTTTTCTCTCTCTCTCTCCCTA
TTCTGTTCTTTGCTCCAGCCTTTCTTTACCTCTACCGCCTGGCGACATGTGTGGCTGAATCGTCTGCGAAGCTCA
AGCCCTGTGTCACGACAGATGACATCTTCCAAGAAGCCGCTCGACGCGGTGCAACCTCGCGACCACGGGCCCGAC
TATGAAGAAGTTGAGTCCGGAGTCGAGACCACGGTCACGACGCGGCTGCTCGGTGCCGGCGATGAGACTTCCGAC
AGCGGCCGCTGGACCGGCTTCGACGATTTCGAGGGCCTGCCTTGGTGGCGCAAGCCTTCGGTATGACGCCCGGCT
GCTCCGAGGCCCAACTTGGACGACCCGATAGGCTGATGTGCGATGCGCGCGCGCTGCAGGTCCTGTGGCTGCTCG
GCCCCTTTTCGCTCTTCACCCTCGCCTTTGGCGGCACCCTGGTTCCCAAACTGAACCTGTAAGCGCTCCTCATGC
GCTTACTTGCTCCGGGCAACACTAAATGACGGCCTCTCAAGGGTTCTGGACCTCGTCTGTCGACGGTATTACGCC
GACAAGAGTACCACCACCCTGGCCGTCGGCGGCGACAATCCCATGTGTAGGGCGCCCGAGGTGCAAAGAGACGTG
GCCACCTTTTTGCTCGTCATCAACCTCGTCACCGGCGGCTTGAGCGCTGTCGTCGCTCCCAAGCTAGGCCACTTG
TCCGACCGCTATGGCAGGCGGCGGCTGTTGGCCTTGGCGTCGTGTGGCGGCCTGCTGGGCGAGCTCATCACCGTT
CTGGCCGCCAAGTTTCCCGAGACGGTCGACTATCGCTGGCTAGTTCTCGGGGCCTTGTTTGACGGCATGACAGGC
TCCTTCACCGCTGGCAGCATTCTGAGCCAGTCATACACGAGCGACTGCACGCCCCCGTCCAGGCGAGCCGTTTCC
ATCGGCTACATCCAGGCATGCCTTTTCATGGGCCTGGCTTTTGGTCCCCTTTTGTCCGGCTACTTTGTCAAGTGG
ACTGGCAGTCTCGTGTCCATGTTCTATGTCGCCATCGGCTGCCACGCCTTCTTCGTCCTCTTCGCCGGCTTCGTC
ATACCCGAGTCTTTGTCGGAAAAGAGGCAGCTCGCGGCCCGGGTCAAGTGGCAGCGGGCCCAGGAGGCTCGAACC
ACGGGCGTCGGCTCCCTGCTGTCTGTCGTCAAAAAGTCCAACCCGTTTGCTCCTCTGCAGATGTTGTGGCCTACC
GGTCAGGGAACGTCGACGCGACTGCGCCTCAACCTGTTGACACTGGCTATCTGTGACGCCATCTTCCTCGGAGCC
GCCTTTGCCGTCGGGCCCGTCCTCATGTTGTACGCCGAATTCATGTTCCAATGGGGCAACTTCGAGACGTCACGC
TTCGTCTCTATCCTGTCCCTGACTCGTGTCGTCATCCTCATGGGACTCCTACCGCTCATCAACTATGTGGGACGT
GTGCGGCCCGCGGTCCGGCGGCAGAAACGACTCGGCACGGTACCAGTGGAGAAAAACGCCGGAGCGGATGGGCTC
GACATCTGGATACTCCGCATCGCCCTGGTCTGCGAGGTGCTTGGCTGTCTGGGCTACACCCTAGCTCGCGACCAG
GGCCCATTCGTGGCCAGCGGCATGATGACGGCCTTTGGCGGGCTTGGGAGCGCCACGACGCAGGCCGCCGTGACC
AAACACGTGCCGCCGGAGCGGGTGGGCCAGATGCTCGGCGCTATCGGCATGCTGCACGCTCTGTCGAGGGTTGTC
GGCCCCGTCATCTTCAGCGGCCTGTACGCCGGAACGGTGAAGACATTTCCGCAGGCCGTCTTCCTTGCCCTCGGC
AGCTTGTTTGCCTTTGCTCTCGTCGCCACTCTAGCTATTAAGCCGCACGGTATGTTTCTGACAGATTCGTCGTGG
TGTCGTGACAGCTGACCTCGTGGACAGTCCACTGGCACGAAGCTCTCGAGGAGCAAAGCGAGCCGCGACGGCGTA
CGCCGCAACGGCTGTACAGCACCATAGTCGAAACGCTGCCCATCGACGAGGACCAAGTGCGCTTACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail