Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7021
Gene name
Locationscaffold_65:3866..5999
Strand-
Gene length (bp)2133
Transcript length (bp)1608
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-25 44 362
PF00083 Sugar_tr Sugar (and other) transporter 9.9E-09 64 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 26 508 6.0E-67
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 29 483 1.0E-41
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 6 483 5.0E-39
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 19 489 8.0E-39
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 46 251 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 26 508 6.0E-67
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 29 483 1.0E-41
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 6 483 5.0E-39
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 19 489 8.0E-39
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 46 251 2.0E-11
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 38 188 4.0E-10
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 50 194 5.0E-10
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 45 194 1.0E-09
sp|P0A4K5|PMRA_STRR6 Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pmrA PE=3 SV=1 46 185 9.0E-09
sp|P0A4K4|PMRA_STRPN Multi-drug resistance efflux pump PmrA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pmrA PE=3 SV=1 46 185 9.0E-09
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 43 254 2.0E-07
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 65 196 2.0E-07
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 60 181 3.0E-07
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 3 199 3.0E-07
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 73 199 5.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 43 181 1.0E-06
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 65 190 1.0E-06
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 78 199 1.0E-06
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 66 246 1.0E-06
sp|E8XY75|MDTG_RAHSY Multidrug resistance protein MdtG OS=Rahnella sp. (strain Y9602) GN=mdtG PE=3 SV=1 30 125 2.0E-06
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 38 187 2.0E-06
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 63 224 2.0E-06
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 74 199 5.0E-06
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 74 199 5.0E-06
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 74 199 5.0E-06
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 74 199 5.0E-06
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 74 199 5.0E-06
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 74 199 5.0E-06
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 74 199 5.0E-06
sp|A1JN04|MDTG_YERE8 Multidrug resistance protein MdtG OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtG PE=3 SV=1 46 194 6.0E-06
sp|E3GC98|MDTG_ENTLS Multidrug resistance protein MdtG OS=Enterobacter lignolyticus (strain SCF1) GN=mdtG PE=3 SV=1 46 194 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 71 93 22
3 103 125 22
4 161 183 22
5 205 227 22
6 305 322 17
7 359 381 22
8 388 410 22
9 420 442 22
10 455 477 22
11 487 509 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7021
MPIRTQTQASFDFVPVFAVARLRNPDDFPKLQLFLLAIVRLAEPIALTSIFPYAWALVKRFKIGNEQNASFYAGL
LISSFSLAEALMGMYWGGLSDRIGRKPVLILGCVGTMFSMIMVGFASNIWIALFGRAVGGLLNGNIGVIQTMVGE
LVTKPEHEPRAFAVMPFVWSIGTIVGPCIGGTFADPHSSWPQAFPAGGLFERFPYLLPNLLCAVLLLISIALGFV
LLEETHPDMQPRVLLPADTYLSEETPLIETSDAMKRPAVDLRAETYGTMRSINGEAFQEEASALSVEKVGSAAPI
WNKRVVGFIIALSIFTYHSMTYDHLMPIFFEDDRASTAALLNATSSKFSGGLGLSLRDVGGIMAVNGAIALFVQA
VIFPLAAERFGVYRLFLIVTVLHPVVYAIVPLLLLAPRYLVFPAIYTCLAIRNMLSITLYPLLLILIKEATPSSS
ALGKVNGLAASAGAACRMVAPPVAGFLYAYGSKMNCSALAWWGSALVAVMGAVQCFSVPRNKGAEKSEESGRLMA
AAGERAEDEI
Coding >Ophio5|7021
ATGCCCATCCGTACACAAACACAAGCATCTTTCGACTTTGTGCCTGTGTTTGCTGTCGCCCGTCTCCGCAACCCC
GACGACTTTCCAAAGCTTCAACTGTTCTTGCTGGCCATTGTACGTCTCGCCGAACCCATCGCTCTCACCTCCATC
TTTCCCTATGCTTGGGCTCTGGTCAAGAGATTCAAAATCGGCAATGAACAAAATGCATCCTTCTACGCTGGCCTT
CTCATCTCCTCCTTTTCCCTGGCCGAGGCCCTCATGGGAATGTACTGGGGCGGTTTGTCGGATCGCATCGGTCGC
AAGCCCGTCTTGATTCTCGGCTGCGTGGGCACCATGTTTAGTATGATCATGGTAGGCTTCGCTTCCAACATTTGG
ATCGCCTTATTCGGACGAGCCGTCGGTGGTCTTCTCAACGGCAACATCGGAGTTATCCAGACCATGGTCGGCGAG
CTTGTCACCAAGCCAGAACACGAACCTCGCGCCTTTGCCGTCATGCCTTTCGTCTGGAGCATTGGGACCATTGTT
GGACCCTGCATTGGCGGAACCTTTGCCGATCCTCATTCGTCCTGGCCCCAGGCTTTCCCCGCAGGCGGCTTATTT
GAGCGCTTCCCATATCTACTTCCCAACTTGCTGTGTGCCGTCCTCCTGCTCATCAGCATTGCCTTGGGCTTCGTC
CTCCTCGAAGAGACACATCCTGACATGCAACCTCGAGTTCTACTCCCGGCGGACACGTACCTGTCAGAGGAGACT
CCGCTGATCGAGACGTCGGATGCCATGAAGCGACCGGCAGTCGACCTTCGCGCTGAGACTTATGGCACTATGCGG
AGCATCAACGGCGAGGCCTTCCAGGAAGAGGCCTCTGCCCTGAGTGTGGAAAAGGTTGGGTCGGCGGCGCCCATC
TGGAACAAGCGCGTGGTTGGCTTCATCATCGCCCTATCCATCTTCACCTACCACTCCATGACGTACGACCACCTC
ATGCCCATCTTCTTCGAGGATGATCGTGCGTCGACGGCCGCCCTTTTGAATGCCACCTCTTCCAAGTTTTCCGGT
GGGCTGGGACTCTCTCTCCGCGACGTGGGCGGCATCATGGCCGTCAACGGTGCCATCGCTCTGTTCGTTCAGGCC
GTCATCTTTCCGCTTGCTGCGGAGAGGTTTGGTGTGTATCGACTCTTCCTCATTGTCACGGTGCTGCACCCGGTT
GTGTATGCCATCGTCCCCTTGCTCCTCCTCGCCCCGCGATATCTCGTCTTTCCGGCCATTTACACTTGCCTCGCC
ATCCGCAATATGCTCTCCATCACCCTCTATCCACTCCTTCTTATCCTCATCAAGGAGGCGACGCCTTCGTCGAGC
GCGCTGGGCAAGGTTAATGGATTGGCTGCCAGCGCCGGCGCCGCATGCCGCATGGTGGCTCCTCCCGTGGCCGGC
TTTCTCTACGCCTACGGCAGCAAGATGAACTGCTCCGCCCTGGCGTGGTGGGGTAGCGCCTTGGTCGCGGTCATG
GGCGCGGTGCAGTGCTTTTCGGTTCCTCGCAACAAGGGCGCGGAAAAGTCGGAGGAGAGTGGCAGACTGATGGCT
GCTGCCGGCGAGAGGGCGGAAGACGAGATT
Transcript >Ophio5|7021
ATGCCCATCCGTACACAAACACAAGCATCTTTCGACTTTGTGCCTGTGTTTGCTGTCGCCCGTCTCCGCAACCCC
GACGACTTTCCAAAGCTTCAACTGTTCTTGCTGGCCATTGTACGTCTCGCCGAACCCATCGCTCTCACCTCCATC
TTTCCCTATGCTTGGGCTCTGGTCAAGAGATTCAAAATCGGCAATGAACAAAATGCATCCTTCTACGCTGGCCTT
CTCATCTCCTCCTTTTCCCTGGCCGAGGCCCTCATGGGAATGTACTGGGGCGGTTTGTCGGATCGCATCGGTCGC
AAGCCCGTCTTGATTCTCGGCTGCGTGGGCACCATGTTTAGTATGATCATGGTAGGCTTCGCTTCCAACATTTGG
ATCGCCTTATTCGGACGAGCCGTCGGTGGTCTTCTCAACGGCAACATCGGAGTTATCCAGACCATGGTCGGCGAG
CTTGTCACCAAGCCAGAACACGAACCTCGCGCCTTTGCCGTCATGCCTTTCGTCTGGAGCATTGGGACCATTGTT
GGACCCTGCATTGGCGGAACCTTTGCCGATCCTCATTCGTCCTGGCCCCAGGCTTTCCCCGCAGGCGGCTTATTT
GAGCGCTTCCCATATCTACTTCCCAACTTGCTGTGTGCCGTCCTCCTGCTCATCAGCATTGCCTTGGGCTTCGTC
CTCCTCGAAGAGACACATCCTGACATGCAACCTCGAGTTCTACTCCCGGCGGACACGTACCTGTCAGAGGAGACT
CCGCTGATCGAGACGTCGGATGCCATGAAGCGACCGGCAGTCGACCTTCGCGCTGAGACTTATGGCACTATGCGG
AGCATCAACGGCGAGGCCTTCCAGGAAGAGGCCTCTGCCCTGAGTGTGGAAAAGGTTGGGTCGGCGGCGCCCATC
TGGAACAAGCGCGTGGTTGGCTTCATCATCGCCCTATCCATCTTCACCTACCACTCCATGACGTACGACCACCTC
ATGCCCATCTTCTTCGAGGATGATCGTGCGTCGACGGCCGCCCTTTTGAATGCCACCTCTTCCAAGTTTTCCGGT
GGGCTGGGACTCTCTCTCCGCGACGTGGGCGGCATCATGGCCGTCAACGGTGCCATCGCTCTGTTCGTTCAGGCC
GTCATCTTTCCGCTTGCTGCGGAGAGGTTTGGTGTGTATCGACTCTTCCTCATTGTCACGGTGCTGCACCCGGTT
GTGTATGCCATCGTCCCCTTGCTCCTCCTCGCCCCGCGATATCTCGTCTTTCCGGCCATTTACACTTGCCTCGCC
ATCCGCAATATGCTCTCCATCACCCTCTATCCACTCCTTCTTATCCTCATCAAGGAGGCGACGCCTTCGTCGAGC
GCGCTGGGCAAGGTTAATGGATTGGCTGCCAGCGCCGGCGCCGCATGCCGCATGGTGGCTCCTCCCGTGGCCGGC
TTTCTCTACGCCTACGGCAGCAAGATGAACTGCTCCGCCCTGGCGTGGTGGGGTAGCGCCTTGGTCGCGGTCATG
GGCGCGGTGCAGTGCTTTTCGGTTCCTCGCAACAAGGGCGCGGAAAAGTCGGAGGAGAGTGGCAGACTGATGGCT
GCTGCCGGCGAGAGGGCGGAAGACGAGATTTAA
Gene >Ophio5|7021
ATGCCCATGTCAGTACCCCGTTTAATGAATATAGCATCCATCGACGTGCATGCGCGCCGGGGCTTTCTCGTTACT
ATCTAAACACACTGTGCGGGGACGTGCCCCCAGCTAATACCACGGGCTTGAAAAGCCTCGCCGCCCGCTCAACTC
CGCCTCCCTCCTTCTTCTCTGCTCCTCTCTCGCTTCAACGGCCTTCTGCGTCTCTCACGACAAGCCATCGCTGCT
CTCTCTTTCGCGTTACACTCTCACCCTCCAGTCCGCCTCAGCTTTCAAGGCTTCCCTCTGTCTCTGGGTATCTCC
CAGTCGGGCGGAGGAGCTAAGACAAAAATATCACCGACTGTCAACAAACAATAATCACAACAACAGCCGTACACA
AACACAAGCATCTTTCGACTTTGTGCCTGTGTTTGCTGTCGTAAGCGCTCGACTCGTGGAGAAGCCATGACCCTA
ACGAAGCAGGCCCGTCTCCGCAACCCCGACGACTTTCCAAAGCTTCAACTGTTCTTGCTGGGTAGGCTGCCCGTC
CCTTGGTCTTGTTGTCGTTATTGTCCACGGCTGACTCGCTACCGGCCGCAGCCATTGTACGTCTCGCCGAACCCA
TCGCTCTCACCTCCATCTTTCCCTATGCTTGGGCTCTGGTCAAGAGATTCAAAATCGGCAATGAACAAAATGCAT
CCTTCTACGCTGGCCTTCTCATCTCCTCCTTTTCCCTGGCCGAGGCCCTCATGGGAATGTACTGGGGCGGTTTGT
CGGATCGCATCGGTCGCAAGCCCGTCTTGATTCTCGGCTGCGTGGGCACCATGTTTAGTATGATCATGGTAGGCT
TCGCTTCCAACATTTGGATCGCCTTATTCGGACGAGCCGTCGGTGGTCTTCTCAACGGCAACATCGGAGTTATCC
AGACCATGGTCGGCGAGCTTGTCACCAAGCCAGAACACGAACGTGAGTTTGCGTTGCCCGCTGCGACCACAGTCT
CCGTCTTGCTGACTCTCTTGCGCAGCTCGCGCCTTTGCCGTCATGCCTTTCGTCTGGAGCATTGGGACCATTGTT
GGACCCTGCATTGGCGGAACCTTTGCCGATCCTCATTCGTCCTGGCCCCAGGCTTTCCCCGCAGGCGGCTTATTT
GAGCGCTTCCCATATCTACTTCCCAACTTGCTGTGTGCCGTCCTCCTGCTCATCAGCATTGCCTTGGGCTTCGTC
CTCCTCGAAGAGACACATCCTGACATGCAACCTCGAGTTCTACTCCCGGCGGACACGTACCTGTCAGAGGAGACT
CCGCTGATCGAGACGTCGGATGCCATGAAGCGACCGGCAGTCGACCTTCGCGCTGAGACTTATGGCACTATGCGG
AGCATCAACGGCGAGGCCTTCCAGGAAGAGGCCTCTGCCCTGAGTGTGGAAAAGGTTGGGTCGGCGGCGCCCATC
TGGAACAAGCGCGTGGTTGGCTTCATCATCGCCCTATCCATCTTCACCTACCACTCCATGACGTACGACCACCTC
ATGCCCATCTTCTTCGAGGATGATCGTGCGTCGACGGCCGCCCTTTTGAATGCCACCTCTTCCAAGTTTTCCGGT
GGGCTGGGACTCTCTCTCCGCGACGTGGGCGGCATCATGGCCGTCAACGGTGCCATCGCTCTGTTCGTTCAGGCC
GTCATCTTTCCGCTTGCTGCGGAGAGGTTTGGTGTGTATCGACTCTTCCTCATTGTCACGGTGCTGCACCCGGTT
GTGTATGCCATCGTCCCCTTGCTCCTCCTCGCCCCGCGATATCTCGTCTTTCCGGCCATTTACACTTGCCTCGCC
ATCCGCAATATGCTCTCCATCACCCTCTATCCACTCCTTCTTATCCTCATCAAGGAGGCGACGCCTTCGTCGAGC
GCGCTGGGCAAGGTTAATGGATTGGCTGCCAGCGCCGGCGCCGCATGCCGCATGGTGGCTCCTCCCGTGGCCGGC
TTTCTCTACGCCTACGGCAGCAAGATGAACTGCTCCGCCCTGGCGTGGTGGGGTAGCGCCTTGGTCGCGGTCATG
GGCGCGGTGCAGTGCTTTTCGGTTCCTCGCAACAAGGGCGCGGAAAAGTCGGAGGAGAGTGGCAGACTGATGGCT
GCTGCCGGCGAGAGGGCGGAAGACGAGATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail