Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7019
Gene name
Locationscaffold_649:6112..10367
Strand+
Gene length (bp)4255
Transcript length (bp)4056
Coding sequence length (bp)4053
Protein length (aa) 1351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00271 Helicase_C Helicase conserved C-terminal domain 2.7E-16 841 966
PF04408 HA2 Helicase associated domain (HA2) 1.9E-15 1030 1118
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 1.0E-09 1200 1288
PF00270 DEAD DEAD/DEAH box helicase 2.1E-08 595 753
PF05773 RWD RWD domain 4.9E-06 402 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 51 1287 0.0E+00
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 56 1268 0.0E+00
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 66 1287 4.0E-177
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 558 1287 1.0E-133
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 572 1287 4.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 51 1287 0.0E+00
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 56 1268 0.0E+00
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 66 1287 4.0E-177
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 558 1287 1.0E-133
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 572 1287 4.0E-133
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 578 1287 6.0E-131
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 565 1287 1.0E-123
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 554 1287 6.0E-121
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 554 1287 6.0E-120
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 539 1223 2.0E-115
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 548 1287 5.0E-115
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 570 1287 6.0E-110
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 560 1287 4.0E-109
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 572 1287 4.0E-108
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 567 1287 4.0E-108
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 565 1157 4.0E-97
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 568 1213 5.0E-96
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 568 1213 6.0E-96
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 568 1213 2.0E-95
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 560 1213 6.0E-95
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 575 1285 3.0E-91
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 566 1224 3.0E-91
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 560 1213 5.0E-91
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 578 1213 6.0E-91
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 575 1285 1.0E-90
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 575 1285 2.0E-90
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 575 1285 8.0E-90
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 575 1285 1.0E-89
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 562 1173 5.0E-89
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 571 1285 6.0E-89
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 562 1173 8.0E-88
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 561 1287 3.0E-87
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 582 1126 1.0E-85
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 570 1287 3.0E-84
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 570 1287 3.0E-84
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 570 1287 4.0E-84
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 575 1287 3.0E-83
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 572 1287 8.0E-82
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 549 1287 4.0E-81
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 573 1286 4.0E-81
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 566 1287 5.0E-81
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 578 1287 1.0E-80
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 573 1287 2.0E-80
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 582 1272 9.0E-80
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 565 1281 1.0E-79
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 572 1287 2.0E-79
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 575 1287 2.0E-79
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 582 1272 5.0E-79
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 573 1287 6.0E-79
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 582 1272 7.0E-79
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 579 1323 8.0E-79
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 575 1287 2.0E-78
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 571 1287 3.0E-77
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 563 1287 3.0E-76
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 573 1286 1.0E-75
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 578 1287 1.0E-75
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 578 1287 1.0E-75
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 573 1286 2.0E-75
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 573 1286 3.0E-75
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 575 1287 6.0E-75
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 575 1287 6.0E-75
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 544 1287 7.0E-75
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 574 1281 2.0E-74
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 579 1287 3.0E-74
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 579 1287 5.0E-74
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 573 1287 6.0E-74
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 573 1287 2.0E-73
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 578 1325 2.0E-73
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 580 1283 3.0E-73
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 570 1286 4.0E-73
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 591 1260 5.0E-73
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 561 1217 1.0E-72
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 580 1149 2.0E-72
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 570 1286 3.0E-72
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 579 1287 2.0E-71
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 557 1117 4.0E-71
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 565 1287 8.0E-71
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 591 1211 1.0E-70
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 578 1117 4.0E-70
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 582 1286 4.0E-70
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 580 1258 6.0E-70
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 555 1241 6.0E-70
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 580 1211 3.0E-69
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 554 1288 9.0E-69
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 591 1211 2.0E-67
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 575 1285 2.0E-67
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 558 1170 7.0E-67
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 573 1311 8.0E-67
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 570 1283 1.0E-66
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 558 1211 3.0E-66
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 574 1257 3.0E-65
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 582 1173 3.0E-64
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 575 1178 1.0E-63
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 582 1173 4.0E-63
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 854 1175 6.0E-62
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 854 1257 9.0E-62
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 582 1250 3.0E-61
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 582 1284 1.0E-59
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 582 1284 1.0E-59
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 582 1270 2.0E-59
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 582 1284 2.0E-59
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 582 1284 4.0E-59
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 829 1215 4.0E-59
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 679 1179 2.0E-58
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 829 1215 4.0E-54
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 591 1127 9.0E-45
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 582 1147 1.0E-42
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 854 1284 3.0E-42
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 574 794 2.0E-41
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 574 797 3.0E-41
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 879 1257 4.0E-41
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 601 1066 4.0E-40
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 572 820 6.0E-38
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 573 818 1.0E-37
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 879 1287 1.0E-36
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 571 1185 3.0E-33
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 879 1272 4.0E-31
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 573 784 6.0E-31
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 879 1214 4.0E-29
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 574 955 5.0E-29
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 583 993 1.0E-28
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 574 874 3.0E-27
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 862 1066 3.0E-27
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 573 780 8.0E-27
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 574 874 1.0E-26
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 574 877 2.0E-25
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 578 1173 5.0E-25
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 578 1173 1.0E-24
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 989 1257 3.0E-24
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 578 1185 5.0E-23
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 600 991 4.0E-22
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 600 991 5.0E-22
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 600 991 5.0E-22
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 600 1189 5.0E-22
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 600 991 6.0E-22
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 572 1185 5.0E-19
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 846 1183 2.0E-15
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 831 1096 1.0E-12
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 578 733 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0005515 protein binding Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7019
MVKKAKEKADKPTAAAAGPSNTSNGLKDGGKGKKGQKKPEPPAAPPAAPPKPTVKQMIGGSSWTGKLPVNLLSEH
CQRMRWEKAEYETRKTAEGFSVWVTLSARDAKTQELTRLEAFKIPASHKHLLVRQTALEAKHAAATYALFRVCNM
QNKHTILPPDHKSLWKEFQALKAQDVKEGKAWMYEADPFKTLQERQDAKAAAEKKRREVEAAKAKAKEMPGASGL
ALLNSAGAGSNAMKGWTTAPKVEMGRQTRLQLEALLRQGISWNPNGIRMTRAQKEGVVDDLSKIGFRRSHVAEAV
EYCKDGEETLEWLLIHVPEDDLPRWAFPENYAAGVSVGATNLRREGIIKSLSETGYAPELCARALDDHDGDESRA
AEALQAMLFPRAPPSGESFLDMGDPDEQWAEEVESLEAMYGDSLLREDDQTIRVRLESVKDAQEARKGEVEAHLR
IRRPATYPEHLILAVVGKLPSYIKLSIIRRALQYSAQSLRDEPLKMYLVTDWVQQHINGIIDDPGKLVDISAVAS
AASDSRPKTATTQLTERRRPTVRKTISWTADARSREDWLKRQQLPSWKDMEAKRRRLPAWRMNDCIVRTVEEHDV
TIISGETGSGKSTQSVQFILDDLYERGLGEQANMMVTQPRRISALGLADRVAEERCSRVGDEVGYAIRGEARRSD
RTRITFVTTGVLLRRLQTSGGRMEDVAASLGDVSHVVIDEVHERSLDTDFLLTLMREVLRGGGGGGGPKLVLMSA
TLDAASFRHYFASEGLSVGLVEIAGRTFPVDEFYLDEVLRMSGFDGEGGGFSGVASSDRGFNGDVKDEAVGRTMK
RLAQRMDYGLLAETVRAIDRELSSEKQTGGILVFLPGVAEINQACGRLRGTSSLQVLPLHGSLETSEQKRVFGRP
AAGKRKVVVATNVAETSITIDDIVAVVDSGKVKETSFDASNNMRRLEERWASQAACEQRRGRAGRVQEGRCYRLF
TRQTQRQMEPRPEPEMRRVPLEQLCLSVRAMGMRDVAGFLERCPTAPSGLAVDGALRLLGRMGALDGTELTALGR
QLAMLPADLRCGKLMVLGALLGCLDDCVTMAAILSTRSPFVTPPPERREAAREARMRFAGGGDGDLLTDLAAVEG
WEEEEEETRWSGRQMRIFCDQHFLSMQALNDIVSTRTQLYTALTEIGLTRPDRNRDRNRKRGANPTSPDRDTQLL
RGLVAAAFAPQVARIQYPDRKYASGMSGAVELDPEARAIKFFTQESGRVFVHPASTLFGCQAFTGEAAYVSYFGI
MATSKVFIRDLTRNMGSPERVRTPPLLRRHRARHARPRPRRRRLDQATRLGPHRGTGRQTARSAGWSAGQEGGEA
R
Coding >Ophio5|7019
ATGGTGAAAAAGGCAAAGGAAAAGGCCGACAAGCCAACGGCGGCAGCAGCGGGCCCGTCGAACACGTCCAACGGC
CTCAAGGATGGCGGCAAGGGCAAAAAGGGCCAGAAGAAGCCGGAGCCGCCAGCAGCGCCTCCCGCGGCTCCGCCG
AAGCCGACGGTCAAGCAGATGATCGGGGGCTCCTCGTGGACCGGAAAGCTTCCCGTCAATCTACTGAGCGAGCAC
TGTCAGAGGATGCGGTGGGAGAAGGCCGAGTACGAGACGCGCAAGACGGCCGAAGGCTTCTCGGTGTGGGTGACG
CTGAGCGCGCGAGACGCCAAGACGCAAGAGCTCACGCGGCTCGAGGCCTTTAAAATCCCAGCCAGCCACAAGCAC
CTACTGGTGAGGCAGACGGCGCTCGAGGCCAAGCACGCGGCGGCGACGTACGCGCTGTTCCGGGTGTGCAACATG
CAGAACAAGCACACGATCCTACCGCCGGACCACAAGTCGCTTTGGAAGGAGTTCCAGGCGCTCAAGGCGCAGGAC
GTCAAGGAGGGCAAGGCGTGGATGTACGAGGCGGACCCGTTCAAGACGCTGCAGGAGCGGCAGGATGCCAAGGCG
GCGGCGGAGAAGAAGAGGAGAGAGGTCGAGGCGGCCAAGGCCAAGGCGAAGGAGATGCCGGGGGCCTCGGGCCTG
GCACTTCTCAACAGCGCGGGCGCGGGCTCCAATGCCATGAAGGGGTGGACGACGGCGCCCAAAGTCGAGATGGGC
CGGCAGACGAGGCTACAGCTCGAGGCGCTGCTGCGGCAGGGAATCTCGTGGAACCCAAACGGCATCCGCATGACT
CGGGCGCAAAAGGAGGGCGTCGTCGACGACCTGTCCAAGATTGGCTTCCGACGCAGCCACGTGGCCGAGGCGGTG
GAATACTGCAAAGACGGCGAGGAGACGCTGGAATGGCTCCTCATCCACGTGCCGGAGGACGACCTGCCGCGATGG
GCCTTTCCCGAGAACTACGCGGCCGGCGTGTCGGTGGGCGCGACCAACCTGAGGAGGGAGGGCATAATCAAGTCG
CTCTCGGAGACGGGGTACGCGCCCGAGCTCTGTGCCCGAGCACTCGACGATCATGACGGGGATGAGAGCCGGGCG
GCGGAGGCGCTGCAGGCGATGCTCTTCCCGAGGGCTCCCCCGTCCGGCGAAAGCTTCCTGGACATGGGGGACCCC
GACGAGCAATGGGCGGAGGAGGTGGAGAGTCTCGAGGCCATGTACGGCGACAGCTTGCTCCGCGAGGACGACCAG
ACCATCCGGGTGCGACTGGAATCGGTCAAGGACGCGCAGGAGGCACGGAAAGGCGAGGTGGAGGCCCATCTGCGG
ATCCGACGGCCGGCGACGTATCCCGAGCACCTGATTCTGGCCGTCGTCGGCAAGCTGCCGTCATACATCAAGCTG
AGCATCATCCGGAGGGCGCTGCAGTACTCGGCGCAATCGTTGCGGGACGAGCCCCTGAAGATGTACCTGGTGACG
GACTGGGTGCAACAACACATCAACGGCATCATCGACGACCCGGGAAAGCTCGTCGACATTTCCGCCGTCGCATCG
GCCGCGTCCGACAGCCGGCCGAAGACGGCGACGACACAGCTGACGGAGCGGAGGCGGCCGACGGTGCGTAAGACG
ATCTCGTGGACGGCGGACGCGCGGAGCAGAGAGGATTGGCTCAAGCGGCAGCAGCTGCCTTCATGGAAGGACATG
GAGGCGAAGCGGCGAAGGCTGCCGGCGTGGCGAATGAACGACTGCATCGTCCGGACGGTGGAGGAGCACGACGTG
ACCATCATCAGCGGCGAGACGGGCTCGGGCAAGTCGACGCAGTCGGTGCAGTTCATCCTCGACGACCTGTACGAG
AGGGGCCTCGGCGAGCAGGCCAACATGATGGTGACGCAGCCGCGTCGGATCTCGGCCCTGGGGCTGGCAGACCGC
GTGGCCGAGGAGCGATGCTCGCGCGTGGGCGACGAGGTGGGCTACGCCATCCGCGGCGAGGCTCGACGATCGGAC
AGGACGCGCATCACGTTTGTGACGACGGGCGTGCTGCTCAGACGGCTCCAGACGTCGGGCGGACGGATGGAAGAC
GTGGCGGCCTCGCTGGGGGACGTGAGCCACGTCGTCATCGACGAGGTGCACGAGAGGAGTCTCGACACCGACTTC
TTGCTCACACTCATGCGCGAGGTTCTCAGGGGGGGGGGAGGGGGCGGCGGGCCGAAGCTGGTGCTCATGTCGGCG
ACGCTGGATGCCGCTTCGTTTAGGCACTACTTTGCGTCCGAGGGGCTCTCCGTCGGCCTGGTGGAGATTGCCGGG
CGGACGTTTCCGGTCGACGAGTTTTACCTGGACGAGGTGCTGAGGATGAGCGGCTTCGATGGCGAGGGGGGGGGT
TTCTCCGGGGTCGCGTCATCGGACCGGGGGTTCAACGGCGACGTCAAGGACGAGGCCGTGGGCCGGACGATGAAG
CGGCTGGCCCAGCGGATGGACTACGGTCTGCTGGCGGAGACGGTCCGGGCCATCGATCGGGAGCTCAGCTCGGAG
AAGCAGACGGGCGGCATCCTCGTCTTCCTGCCGGGCGTGGCCGAGATCAACCAGGCGTGCGGCCGGCTGCGGGGG
ACGAGCTCGCTACAGGTGTTGCCCCTACACGGATCGCTGGAGACGAGCGAGCAGAAGCGGGTGTTTGGGCGGCCG
GCGGCGGGCAAGCGCAAGGTGGTGGTGGCGACCAACGTGGCCGAGACGTCCATCACCATCGACGACATCGTGGCC
GTCGTCGACAGCGGCAAGGTCAAGGAGACGAGCTTCGACGCCAGCAACAACATGCGGCGGCTGGAGGAGCGCTGG
GCGTCACAGGCGGCTTGCGAGCAGCGGCGAGGACGAGCGGGACGGGTTCAAGAGGGCCGCTGCTACAGGCTCTTC
ACCCGGCAGACGCAGCGGCAGATGGAGCCGAGGCCGGAGCCGGAGATGCGACGGGTGCCGCTGGAGCAGCTGTGT
CTGTCGGTGCGGGCCATGGGCATGCGAGACGTGGCCGGCTTCCTGGAGCGATGCCCCACGGCTCCGTCCGGACTG
GCCGTCGACGGCGCGCTACGACTGCTCGGACGGATGGGCGCCCTCGACGGCACGGAGCTGACGGCGCTGGGACGA
CAGCTGGCGATGCTGCCGGCCGACCTGCGCTGCGGCAAGCTGATGGTCCTGGGCGCGCTGTTGGGCTGTCTGGAC
GACTGCGTCACCATGGCCGCCATCCTGAGCACGCGGAGCCCGTTTGTGACGCCGCCGCCGGAGAGGCGCGAGGCG
GCTCGAGAGGCCCGGATGAGATTCGCCGGAGGAGGAGACGGGGATCTACTGACGGATCTGGCGGCGGTGGAAGGC
TGGGAGGAGGAGGAGGAGGAGACGAGGTGGTCGGGACGGCAGATGCGCATCTTTTGCGACCAACACTTCCTATCG
ATGCAGGCCCTCAACGACATCGTCTCGACGAGGACCCAGCTCTACACGGCGCTGACGGAGATTGGACTCACGAGG
CCGGACCGGAACCGGGACCGGAACCGGAAGCGGGGCGCCAACCCGACCAGCCCGGACCGGGACACGCAGCTGCTC
CGGGGCCTGGTGGCGGCAGCCTTTGCGCCGCAGGTGGCGCGGATCCAATATCCGGACCGCAAGTACGCGAGCGGC
ATGTCGGGCGCCGTCGAGCTGGACCCGGAGGCTCGGGCCATCAAGTTTTTCACGCAGGAGAGCGGGCGGGTGTTT
GTGCATCCGGCGAGCACGCTGTTTGGCTGTCAGGCCTTTACGGGCGAGGCGGCGTACGTTTCGTATTTTGGCATC
ATGGCGACGAGCAAGGTGTTTATACGAGACTTGACGCGCAACATGGGCAGCCCTGAACGCGTACGGACTCCTCCT
CTTCTGCGGCGCCATCGAGCTCGACACGCTCGGCCGCGGCCTCGTCGTCGACGGCTGGATCAGGCTACGCGGCTG
GGCCCGCATCGGGGTACTGGTCGCCAGACTGCGCGGTCTGCTGGATGGTCTGCTGGCCAGGAGGGTGGAGAGGCC
CGG
Transcript >Ophio5|7019
ATGGTGAAAAAGGCAAAGGAAAAGGCCGACAAGCCAACGGCGGCAGCAGCGGGCCCGTCGAACACGTCCAACGGC
CTCAAGGATGGCGGCAAGGGCAAAAAGGGCCAGAAGAAGCCGGAGCCGCCAGCAGCGCCTCCCGCGGCTCCGCCG
AAGCCGACGGTCAAGCAGATGATCGGGGGCTCCTCGTGGACCGGAAAGCTTCCCGTCAATCTACTGAGCGAGCAC
TGTCAGAGGATGCGGTGGGAGAAGGCCGAGTACGAGACGCGCAAGACGGCCGAAGGCTTCTCGGTGTGGGTGACG
CTGAGCGCGCGAGACGCCAAGACGCAAGAGCTCACGCGGCTCGAGGCCTTTAAAATCCCAGCCAGCCACAAGCAC
CTACTGGTGAGGCAGACGGCGCTCGAGGCCAAGCACGCGGCGGCGACGTACGCGCTGTTCCGGGTGTGCAACATG
CAGAACAAGCACACGATCCTACCGCCGGACCACAAGTCGCTTTGGAAGGAGTTCCAGGCGCTCAAGGCGCAGGAC
GTCAAGGAGGGCAAGGCGTGGATGTACGAGGCGGACCCGTTCAAGACGCTGCAGGAGCGGCAGGATGCCAAGGCG
GCGGCGGAGAAGAAGAGGAGAGAGGTCGAGGCGGCCAAGGCCAAGGCGAAGGAGATGCCGGGGGCCTCGGGCCTG
GCACTTCTCAACAGCGCGGGCGCGGGCTCCAATGCCATGAAGGGGTGGACGACGGCGCCCAAAGTCGAGATGGGC
CGGCAGACGAGGCTACAGCTCGAGGCGCTGCTGCGGCAGGGAATCTCGTGGAACCCAAACGGCATCCGCATGACT
CGGGCGCAAAAGGAGGGCGTCGTCGACGACCTGTCCAAGATTGGCTTCCGACGCAGCCACGTGGCCGAGGCGGTG
GAATACTGCAAAGACGGCGAGGAGACGCTGGAATGGCTCCTCATCCACGTGCCGGAGGACGACCTGCCGCGATGG
GCCTTTCCCGAGAACTACGCGGCCGGCGTGTCGGTGGGCGCGACCAACCTGAGGAGGGAGGGCATAATCAAGTCG
CTCTCGGAGACGGGGTACGCGCCCGAGCTCTGTGCCCGAGCACTCGACGATCATGACGGGGATGAGAGCCGGGCG
GCGGAGGCGCTGCAGGCGATGCTCTTCCCGAGGGCTCCCCCGTCCGGCGAAAGCTTCCTGGACATGGGGGACCCC
GACGAGCAATGGGCGGAGGAGGTGGAGAGTCTCGAGGCCATGTACGGCGACAGCTTGCTCCGCGAGGACGACCAG
ACCATCCGGGTGCGACTGGAATCGGTCAAGGACGCGCAGGAGGCACGGAAAGGCGAGGTGGAGGCCCATCTGCGG
ATCCGACGGCCGGCGACGTATCCCGAGCACCTGATTCTGGCCGTCGTCGGCAAGCTGCCGTCATACATCAAGCTG
AGCATCATCCGGAGGGCGCTGCAGTACTCGGCGCAATCGTTGCGGGACGAGCCCCTGAAGATGTACCTGGTGACG
GACTGGGTGCAACAACACATCAACGGCATCATCGACGACCCGGGAAAGCTCGTCGACATTTCCGCCGTCGCATCG
GCCGCGTCCGACAGCCGGCCGAAGACGGCGACGACACAGCTGACGGAGCGGAGGCGGCCGACGGTGCGTAAGACG
ATCTCGTGGACGGCGGACGCGCGGAGCAGAGAGGATTGGCTCAAGCGGCAGCAGCTGCCTTCATGGAAGGACATG
GAGGCGAAGCGGCGAAGGCTGCCGGCGTGGCGAATGAACGACTGCATCGTCCGGACGGTGGAGGAGCACGACGTG
ACCATCATCAGCGGCGAGACGGGCTCGGGCAAGTCGACGCAGTCGGTGCAGTTCATCCTCGACGACCTGTACGAG
AGGGGCCTCGGCGAGCAGGCCAACATGATGGTGACGCAGCCGCGTCGGATCTCGGCCCTGGGGCTGGCAGACCGC
GTGGCCGAGGAGCGATGCTCGCGCGTGGGCGACGAGGTGGGCTACGCCATCCGCGGCGAGGCTCGACGATCGGAC
AGGACGCGCATCACGTTTGTGACGACGGGCGTGCTGCTCAGACGGCTCCAGACGTCGGGCGGACGGATGGAAGAC
GTGGCGGCCTCGCTGGGGGACGTGAGCCACGTCGTCATCGACGAGGTGCACGAGAGGAGTCTCGACACCGACTTC
TTGCTCACACTCATGCGCGAGGTTCTCAGGGGGGGGGGAGGGGGCGGCGGGCCGAAGCTGGTGCTCATGTCGGCG
ACGCTGGATGCCGCTTCGTTTAGGCACTACTTTGCGTCCGAGGGGCTCTCCGTCGGCCTGGTGGAGATTGCCGGG
CGGACGTTTCCGGTCGACGAGTTTTACCTGGACGAGGTGCTGAGGATGAGCGGCTTCGATGGCGAGGGGGGGGGT
TTCTCCGGGGTCGCGTCATCGGACCGGGGGTTCAACGGCGACGTCAAGGACGAGGCCGTGGGCCGGACGATGAAG
CGGCTGGCCCAGCGGATGGACTACGGTCTGCTGGCGGAGACGGTCCGGGCCATCGATCGGGAGCTCAGCTCGGAG
AAGCAGACGGGCGGCATCCTCGTCTTCCTGCCGGGCGTGGCCGAGATCAACCAGGCGTGCGGCCGGCTGCGGGGG
ACGAGCTCGCTACAGGTGTTGCCCCTACACGGATCGCTGGAGACGAGCGAGCAGAAGCGGGTGTTTGGGCGGCCG
GCGGCGGGCAAGCGCAAGGTGGTGGTGGCGACCAACGTGGCCGAGACGTCCATCACCATCGACGACATCGTGGCC
GTCGTCGACAGCGGCAAGGTCAAGGAGACGAGCTTCGACGCCAGCAACAACATGCGGCGGCTGGAGGAGCGCTGG
GCGTCACAGGCGGCTTGCGAGCAGCGGCGAGGACGAGCGGGACGGGTTCAAGAGGGCCGCTGCTACAGGCTCTTC
ACCCGGCAGACGCAGCGGCAGATGGAGCCGAGGCCGGAGCCGGAGATGCGACGGGTGCCGCTGGAGCAGCTGTGT
CTGTCGGTGCGGGCCATGGGCATGCGAGACGTGGCCGGCTTCCTGGAGCGATGCCCCACGGCTCCGTCCGGACTG
GCCGTCGACGGCGCGCTACGACTGCTCGGACGGATGGGCGCCCTCGACGGCACGGAGCTGACGGCGCTGGGACGA
CAGCTGGCGATGCTGCCGGCCGACCTGCGCTGCGGCAAGCTGATGGTCCTGGGCGCGCTGTTGGGCTGTCTGGAC
GACTGCGTCACCATGGCCGCCATCCTGAGCACGCGGAGCCCGTTTGTGACGCCGCCGCCGGAGAGGCGCGAGGCG
GCTCGAGAGGCCCGGATGAGATTCGCCGGAGGAGGAGACGGGGATCTACTGACGGATCTGGCGGCGGTGGAAGGC
TGGGAGGAGGAGGAGGAGGAGACGAGGTGGTCGGGACGGCAGATGCGCATCTTTTGCGACCAACACTTCCTATCG
ATGCAGGCCCTCAACGACATCGTCTCGACGAGGACCCAGCTCTACACGGCGCTGACGGAGATTGGACTCACGAGG
CCGGACCGGAACCGGGACCGGAACCGGAAGCGGGGCGCCAACCCGACCAGCCCGGACCGGGACACGCAGCTGCTC
CGGGGCCTGGTGGCGGCAGCCTTTGCGCCGCAGGTGGCGCGGATCCAATATCCGGACCGCAAGTACGCGAGCGGC
ATGTCGGGCGCCGTCGAGCTGGACCCGGAGGCTCGGGCCATCAAGTTTTTCACGCAGGAGAGCGGGCGGGTGTTT
GTGCATCCGGCGAGCACGCTGTTTGGCTGTCAGGCCTTTACGGGCGAGGCGGCGTACGTTTCGTATTTTGGCATC
ATGGCGACGAGCAAGGTGTTTATACGAGACTTGACGCGCAACATGGGCAGCCCTGAACGCGTACGGACTCCTCCT
CTTCTGCGGCGCCATCGAGCTCGACACGCTCGGCCGCGGCCTCGTCGTCGACGGCTGGATCAGGCTACGCGGCTG
GGCCCGCATCGGGGTACTGGTCGCCAGACTGCGCGGTCTGCTGGATGGTCTGCTGGCCAGGAGGGTGGAGAGGCC
CGGTGA
Gene >Ophio5|7019
ATGGTGAAAAAGGCAAAGGAAAAGGCCGACAAGCCAACGGCGGCAGCAGCGGGCCCGTCGAACACGTCCAACGGC
CTCAAGGATGGCGGCAAGGGCAAAAAGGGCCAGAAGAAGCCGGAGCCGCCAGCAGCGCCTCCCGCGGCTCCGCCG
AAGCCGACGGTCAAGCAGATGATCGGGGGCTCCTCGTGGACCGGAAAGCTTCCCGTCAATCTACTGAGCGAGCAC
TGTCAGAGGATGCGGTGGGAGAAGGCCGAGTACGAGACGCGCAAGACGGCCGAAGGCTTCTCGGTGTGGGTGACG
CTGAGCGCGCGAGACGCCAAGACGCAAGAGCTCACGCGGCTCGAGGCCTTTAAAATCCCAGCCAGCCACAAGCAC
CTACTGGTGAGGCAGACGGCGCTCGAGGCCAAGCACGCGGCGGCGACGTACGCGCTGTTCCGGGTGTGCAACATG
CAGAACAAGCACACGATCCTACCGCCGGACCACAAGTCGCTTTGGAAGGAGTTCCAGGCGCTCAAGGCGCAGGAC
GTCAAGGAGGGCAAGGCGTGGATGTACGAGGCGGACCCGTTCAAGACGCTGCAGGAGCGGCAGGATGCCAAGGCG
GCGGCGGAGAAGAAGAGGAGAGAGGTCGAGGCGGCCAAGGCCAAGGCGAAGGAGATGCCGGGGGCCTCGGGCCTG
GCACTTCTCAACAGCGCGGGCGCGGGCTCCAATGCCATGAAGGGGTGGACGACGGCGCCCAAAGTCGAGATGGGC
CGGCAGACGAGGCTACAGCTCGAGGCGCTGCTGCGGCAGGGAATCTCGTGGAACCCAAACGGCATCCGCATGACT
CGGGCGCAAAAGGAGGGCGTCGTCGACGACCTGTCCAAGATTGGCTTCCGACGCAGCCACGTGGCCGAGGCGGTG
GAATACTGCAAAGACGGCGAGGAGACGCTGGAATGGCTCCTCATCCACGTGCCGGAGGACGACCTGCCGCGATGG
GCCTTTCCCGAGAACTACGCGGCCGGCGTGTCGGTGGGCGCGACCAACCTGAGGAGGGAGGGCATAATCAAGTCG
CTCTCGGAGACGGGGTACGCGCCCGAGCTCTGTGCCCGAGCACTCGACGATCATGACGGGGATGAGAGCCGGGCG
GCGGAGGCGCTGCAGGCGATGCTCTTCCCGAGGGCTCCCCCGTCCGGCGAAAGCTTCCTGGACATGGGGGACCCC
GACGAGCAATGGGCGGAGGAGGTGGAGAGTCTCGAGGCCATGTACGGCGACAGCTTGCTCCGCGAGGACGACCAG
ACCATCCGGGTGCGACTGGAATCGGTCAAGGACGCGCAGGAGGCACGGAAAGGCGAGGTGGAGGCCCATCTGCGG
ATCCGACGGCCGGCGACGTATCCCGAGCACCTGATTCTGGCCGTCGTCGGCAAGCTGCCGTCATACATCAAGCTG
AGCATCATCCGGAGGGCGCTGCAGTACTCGGCGCAATCGTTGCGGGACGAGCCCCTGAAGATGTACCTGGTGACG
GACTGGGTGCAACAACACATCAACGGCATCATCGACGACCCGGGAAAGCTCGTCGACATTTCCGCCGTCGCATCG
GCCGCGTCCGACAGCCGGCCGAAGACGGCGACGACACAGCTGACGGAGCGGAGGCGGCCGACGGTGCGTAAGACG
ATCTCGTGGACGGCGGACGCGCGGAGCAGAGAGGATTGGCTCAAGCGGCAGCAGCTGCCTTCATGGAAGGACATG
GAGGCGAAGCGGCGAAGGCTGCCGGCGTGGCGAATGAACGACTGCATCGTCCGGACGGTGGAGGAGCACGACGTG
ACCATCATCAGCGGCGAGACGGGCTCGGGCAAGTCGACGCAGTCGGTGCAGTTCATCCTCGACGACCTGTACGAG
AGGGGCCTCGGCGAGCAGGCCAACATGATGGTGACGCAGCCGCGTCGGATCTCGGCCCTGGGGCTGGCAGACCGC
GTGGCCGAGGAGCGATGCTCGCGCGTGGGCGACGAGGTGGGCTACGCCATCCGCGGCGAGGCTCGACGATCGGAC
AGGACGCGCATCACGTTTGTGACGACGGGCGTGCTGCTCAGACGGCTCCAGACGTCGGGCGGACGGATGGAAGAC
GTGGCGGCCTCGCTGGGGGACGTGAGCCACGTCGTCATCGACGAGGTGCACGAGAGGAGTCTCGACACCGACTTC
TTGCTCACACTCATGCGCGAGGTTCTCAGGGGGGGGGGAGGGGGCGGCGGGCCGAAGCTGGTGCTCATGTCGGCG
ACGCTGGATGCCGCTTCGTTTAGGCACTACTTTGCGTCCGAGGGGCTCTCCGTCGGCCTGGTGGAGATTGCCGGG
CGGACGTTTCCGGTCGACGAGTTTTACCTGGACGAGGTGCTGAGGATGAGCGGCTTCGATGGCGAGGGGGGGGGT
TTCTCCGGGGTCGCGTCATCGGACCGGGGGTTCAACGGCGACGTCAAGGACGAGGCCGTGGGCCGGACGATGAAG
CGGCTGGCCCAGCGGATGGACTACGGTCTGCTGGCGGAGACGGTCCGGGCCATCGATCGGGAGCTCAGCTCGGAG
AAGCAGACGGGCGGCATCCTCGTCTTCCTGCCGGGCGTGGCCGAGATCAACCAGGCGTGCGGCCGGCTGCGGGGG
ACGAGCTCGCTACAGGTGTTGCCCCTACACGGATCGCTGGAGACGAGCGAGCAGAAGCGGGTGTTTGGGCGGCCG
GCGGCGGGCAAGCGCAAGGTGGTGGTGGCGACCAACGTGGCCGAGACGTCCATCACCATCGACGACATCGTGGCC
GTCGTCGACAGCGGCAAGGTCAAGGAGACGAGCTTCGACGCCAGCAACAACATGCGGCGGCTGGAGGAGCGCTGG
GCGTCACAGGCGGCTTGCGAGCAGCGGCGAGGACGAGCGGGACGGGTTCAAGAGGGCCGCTGCTACAGGCTCTTC
ACCCGGCAGACGCAGCGGCAGATGGAGCCGAGGCCGGAGCCGGAGATGCGACGGGTGCCGCTGGAGCAGCTGTGT
CTGTCGGTGCGGGCCATGGGCATGCGAGACGTGGCCGGCTTCCTGGAGCGATGCCCCACGGCTCCGTCCGGACTG
GCCGTCGACGGCGCGCTACGACTGCTCGGACGGATGGGCGCCCTCGACGGCACGGAGCTGACGGCGCTGGGACGA
CAGCTGGCGATGCTGCCGGCCGACCTGCGCTGCGGCAAGCTGATGGTCCTGGGCGCGCTGTTGGGCTGTCTGGAC
GACTGCGTCACCATGGCCGCCATCCTGAGCACGCGGAGCCCGTTTGTGACGCCGCCGCCGGAGAGGCGCGAGGCG
GCTCGAGAGGCCCGGATGAGATTCGCCGGAGGAGGAGACGGGGATCTACTGACGGATCTGGCGGCGGTGGAAGGC
TGGGAGGAGGAGGAGGAGGAGACGAGGTGGTCGGGACGGCAGATGCGCATCTTTTGCGACCAACACTTCCTATCG
ATGCAGGCCCTCAACGACATCGTCTCGACGAGGACCCAGCTCTACACGGCGCTGACGGAGATTGGACTCACGAGG
CCGGACCGGAACCGGGACCGGAACCGGAAGCGGGGCGCCAACCCGACCAGCCCGGACCGGGACACGCAGCTGCTC
CGGGGCCTGGTGGCGGCAGCCTTTGCGCCGCAGGTGGCGCGGATCCAATATCCGGACCGCAAGTACGCGAGCGGC
ATGTCGGGCGCCGTCGAGCTGGACCCGGAGGCTCGGGCCATCAAGTTTTTCACGCAGGAGAGCGGGCGGGTGTTT
GTGCATCCGGCGAGCACGCTGTTTGGCTGTCAGGCCTTTACGGGCGAGGCGGCGTACGTTTCGTATTTTGGCATC
ATGGCGACGAGCAAGGTGTTTATACGAGACTTGACGCGTGGGTTTTTCTCTCTCCCTCCCTCCCTCCCTCTTCCT
CCCTCTTTTTCTCTTTTTCCCCTTTTCTCTCCCTCTCTCTCTCTCTCTATCTTTCTCTCTCTCTCTCTATCTTTC
TTTCTGTTCTTCTTCTCTCTCTCTCTCTCTGTCTCTCTCTTCCTTTTTTTTTTTTTATTTTTATGTCACACATGA
GCTAAACACAGGCAACATGGGCAGCCCTGAACGCGTACGGACTCCTCCTCTTCTGCGGCGCCATCGAGCTCGACA
CGCTCGGCCGCGGCCTCGTCGTCGACGGCTGGATCAGGCTACGCGGCTGGGCCCGCATCGGGGTACTGGTCGCCA
GACTGCGCGGTCTGCTGGATGGTCTGCTGGCCAGGAGGGTGGAGAGGCCCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail