Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7018
Gene name
Locationscaffold_649:3285..5236
Strand+
Gene length (bp)1951
Transcript length (bp)1653
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 1.4E-10 114 153
PF00514 Arm Armadillo/beta-catenin-like repeat 4.4E-13 158 194
PF00514 Arm Armadillo/beta-catenin-like repeat 1.1E-11 197 238
PF00514 Arm Armadillo/beta-catenin-like repeat 2.7E-04 251 279
PF00514 Arm Armadillo/beta-catenin-like repeat 1.6E-07 282 321
PF00514 Arm Armadillo/beta-catenin-like repeat 3.0E-13 324 364
PF00514 Arm Armadillo/beta-catenin-like repeat 7.7E-13 366 405
PF00514 Arm Armadillo/beta-catenin-like repeat 1.8E-08 412 449
PF01749 IBB Importin beta binding domain 4.7E-28 10 103
PF13513 HEAT_EZ HEAT-like repeat 4.1E-09 140 193
PF16186 Arm_3 Atypical Arm repeat 6.2E-23 468 517
PF13646 HEAT_2 HEAT repeats 1.9E-08 129 233
PF02985 HEAT HEAT repeat 2.0E-05 168 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus GN=KPNA1 PE=2 SV=1 8 512 0.0E+00
sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut15 PE=1 SV=1 2 550 0.0E+00
sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii GN=KPNA1 PE=2 SV=1 8 512 0.0E+00
sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus GN=KPNA1 PE=2 SV=1 8 512 0.0E+00
sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens GN=KPNA1 PE=1 SV=3 8 512 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus GN=KPNA1 PE=2 SV=1 8 512 0.0E+00
sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut15 PE=1 SV=1 2 550 0.0E+00
sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii GN=KPNA1 PE=2 SV=1 8 512 0.0E+00
sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus GN=KPNA1 PE=2 SV=1 8 512 0.0E+00
sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens GN=KPNA1 PE=1 SV=3 8 512 0.0E+00
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 3 532 0.0E+00
sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicus GN=Kpna5 PE=2 SV=1 9 517 0.0E+00
sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens GN=KPNA5 PE=1 SV=2 9 541 0.0E+00
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 8 541 0.0E+00
sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 9 541 0.0E+00
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 8 541 0.0E+00
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 9 519 0.0E+00
sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=IMPA2 PE=1 SV=1 8 541 0.0E+00
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 1 550 0.0E+00
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 4 541 0.0E+00
sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=IMPA1 PE=1 SV=2 8 542 0.0E+00
sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 8 541 0.0E+00
sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 8 534 0.0E+00
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 9 519 0.0E+00
sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 8 542 0.0E+00
sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 9 519 0.0E+00
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 9 519 0.0E+00
sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis thaliana GN=IMPA4 PE=1 SV=1 17 542 0.0E+00
sp|P83953|IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicus GN=Kpna1 PE=1 SV=1 8 512 1.0E-179
sp|Q60960|IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus GN=Kpna1 PE=1 SV=2 8 512 1.0E-178
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 8 505 2.0E-172
sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens GN=KPNA4 PE=1 SV=1 9 541 1.0E-161
sp|O35343|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus GN=Kpna4 PE=1 SV=1 9 541 1.0E-160
sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus GN=Kpna3 PE=1 SV=1 9 541 8.0E-159
sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens GN=KPNA3 PE=1 SV=2 1 541 2.0E-158
sp|Q9M9X7|IMPA7_ARATH Importin subunit alpha-7 OS=Arabidopsis thaliana GN=IMPA7 PE=2 SV=1 26 506 5.0E-152
sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus GN=Kpna2 PE=1 SV=2 6 541 6.0E-151
sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 7 541 2.0E-150
sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans GN=ima-3 PE=1 SV=2 13 542 2.0E-144
sp|P52171|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis GN=kpna2 PE=1 SV=2 10 541 2.0E-140
sp|P52170|IMA5_XENLA Importin subunit alpha-5 OS=Xenopus laevis GN=kpna1 PE=1 SV=2 10 541 8.0E-139
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 7 517 1.0E-125
sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melanogaster GN=Pen PE=1 SV=2 10 541 3.0E-123
sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus GN=KPNA7 PE=1 SV=2 7 512 8.0E-121
sp|Q557F4|IMA1A_DICDI Probable importin subunit alpha-A OS=Dictyostelium discoideum GN=DDB_G0273149 PE=3 SV=1 1 528 2.0E-120
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 7 517 2.0E-117
sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus GN=Kpna7 PE=1 SV=1 1 513 8.0E-107
sp|Q9FJ92|IMPA8_ARATH Importin subunit alpha-8 OS=Arabidopsis thaliana GN=IMPA8 PE=3 SV=1 76 502 3.0E-105
sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis elegans GN=ima-2 PE=1 SV=1 17 509 4.0E-97
sp|F4KF65|IMPA9_ARATH Importin subunit alpha-9 OS=Arabidopsis thaliana GN=IMPA9 PE=3 SV=1 27 514 5.0E-46
sp|Q9FYP9|IMAP2_ORYSJ Importin subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os01g0158000 PE=2 SV=1 8 514 1.0E-44
sp|Q22560|IMA1_CAEEL Importin subunit alpha-1 OS=Caenorhabditis elegans GN=ima-1 PE=1 SV=1 1 509 3.0E-21
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 90 402 3.0E-18
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 90 402 8.0E-16
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 73 431 3.0E-15
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 90 431 3.0E-15
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 90 454 6.0E-14
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 90 402 7.0E-14
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 91 402 9.0E-14
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 91 402 9.0E-14
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 90 402 3.0E-13
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 90 402 4.0E-13
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 90 434 2.0E-12
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 51 395 1.0E-11
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 69 401 4.0E-11
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 86 406 4.0E-11
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 86 406 4.0E-11
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 271 451 1.0E-10
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 100 436 2.0E-10
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 116 401 2.0E-10
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 51 390 4.0E-10
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 114 313 5.0E-10
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 90 402 8.0E-10
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 169 457 9.0E-10
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 250 451 1.0E-09
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 161 401 1.0E-09
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 86 337 6.0E-09
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 86 401 6.0E-09
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 86 383 9.0E-09
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 86 383 1.0E-08
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 45 295 1.0E-08
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 86 406 1.0E-08
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 100 436 2.0E-08
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 90 402 2.0E-08
sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 124 458 3.0E-08
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 86 406 4.0E-08
sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 86 383 6.0E-08
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 124 485 6.0E-08
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 86 457 7.0E-08
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 174 483 7.0E-08
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 174 483 7.0E-08
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 45 320 1.0E-07
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 45 320 2.0E-07
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 206 403 4.0E-07
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 86 401 4.0E-07
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 169 449 1.0E-06
sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing protein OS=Mus musculus GN=Ankar PE=2 SV=1 120 383 1.0E-06
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 124 217 2.0E-06
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 86 401 2.0E-06
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 86 359 2.0E-06
sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vac8 PE=1 SV=4 91 474 2.0E-06
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 83 386 3.0E-06
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 118 350 8.0E-06
sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 296 431 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0061608 nuclear import signal receptor activity Yes
GO:0005515 protein binding Yes
GO:0006606 protein import into nucleus Yes
GO:0140104 molecular carrier activity No
GO:0008150 biological_process No
GO:0070727 cellular macromolecule localization No
GO:0071705 nitrogen compound transport No
GO:0033365 protein localization to organelle No
GO:0051234 establishment of localization No
GO:0051169 nuclear transport No
GO:0140142 nucleocytoplasmic carrier activity No
GO:0006886 intracellular protein transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0034504 protein localization to nucleus No
GO:0033036 macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No
GO:0008104 protein localization No
GO:0072594 establishment of protein localization to organelle No
GO:0046907 intracellular transport No
GO:0006913 nucleocytoplasmic transport No
GO:0051170 import into nucleus No
GO:0071702 organic substance transport No
GO:0015031 protein transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7018
MAERYIPEHRRTQFKAKNTFKPEELRRRREEQQVEIRKAKREENLAKRRGIGTGENRPGASLGAAPDSDDESAPT
ESQLNEDLPLMVQGVFSEQIDLQIQATTKFRKLLSKERNPPIEEVIKTGVVSRFVEFLRSPHTLVQFEAAWALTN
IASGSATQTQVVIEAGAVPIFVELLASPEPDVREQAVWALGNIAGDSPQCRDYVLSCGALKPLLNLLGDSRKLSM
LRNATWTLSNFCRGKTPQPDWNTIAPALAVLSKLVYSLDDEVLIDACWAISYLSDGSNDKIQAVIEAGIPRRLVE
LLMHSSTSVQTPALRSVGNIVTGDDVQTQVIINCGALPCLLSLLSSTKDGIRKEACWTISNITAGNSSQIQSVID
ANIIPPLIHLLQNGDLKTRKEACWAISNATSGGLQKPEQIRYLVSQGCIKPLCDLLSCPDNKIIQVALDGLENIL
KIGDLDKQSAGEGADSINRYALFIEECGGMEKIHECQNNANEEIYVKSYHIIEKYFSDDAENDEGMVQPAGANGT
FGFGANGPAQSGGFNFANGGDSMDM
Coding >Ophio5|7018
ATGGCGGAGCGATATATCCCCGAGCATCGCCGGACGCAGTTCAAGGCCAAGAATACGTTCAAACCTGAGGAGCTG
CGTCGTCGTCGCGAGGAGCAGCAGGTTGAGATCCGCAAGGCAAAACGCGAAGAGAACCTGGCCAAGCGACGCGGC
ATCGGCACTGGTGAGAATCGTCCGGGCGCCTCGCTTGGCGCTGCCCCCGACAGTGACGATGAGTCGGCTCCCACG
GAGTCACAGTTAAACGAGGACCTGCCTCTGATGGTTCAGGGCGTCTTCTCGGAACAGATCGACCTCCAGATCCAA
GCCACCACCAAGTTCCGCAAACTCCTGTCCAAGGAGCGAAATCCCCCCATCGAAGAGGTCATCAAGACGGGCGTC
GTCAGCCGCTTCGTCGAATTCCTGCGCTCACCCCATACCCTCGTTCAGTTCGAGGCCGCCTGGGCGCTGACAAAC
ATCGCATCCGGCTCCGCCACCCAGACACAGGTGGTCATCGAGGCCGGCGCCGTGCCCATCTTTGTTGAGCTTCTA
GCCAGCCCGGAGCCTGATGTGCGGGAACAGGCCGTCTGGGCCCTCGGCAACATTGCCGGCGACAGTCCTCAGTGC
CGCGATTATGTGCTCAGCTGCGGCGCCTTGAAGCCCCTGCTGAACCTCCTCGGCGACAGCCGCAAGCTCAGCATG
CTGCGCAATGCCACCTGGACTCTGAGCAACTTTTGCCGTGGCAAGACGCCGCAGCCTGACTGGAACACGATTGCG
CCTGCCCTGGCGGTTCTCTCCAAGCTGGTTTACTCTCTGGATGACGAGGTCCTCATCGATGCTTGCTGGGCCATA
TCCTACTTGTCCGATGGCTCCAACGACAAAATCCAGGCCGTCATTGAGGCTGGCATTCCGCGCAGACTTGTTGAG
CTGCTGATGCACTCCTCGACGTCGGTCCAGACGCCCGCTCTGCGGTCCGTCGGCAACATCGTGACTGGTGACGAC
GTCCAGACGCAGGTCATCATCAACTGTGGCGCTCTGCCGTGCTTGCTGTCCCTCCTCAGCTCTACCAAGGATGGT
ATCCGCAAGGAGGCGTGCTGGACCATTTCCAACATAACGGCTGGCAACTCGTCTCAGATCCAGTCCGTCATCGAC
GCCAATATCATTCCGCCCCTCATTCACTTGCTCCAGAATGGCGACCTCAAGACGCGCAAGGAGGCTTGCTGGGCC
ATCAGTAATGCTACTTCGGGCGGACTCCAGAAGCCAGAGCAGATCCGGTATCTCGTCTCCCAGGGCTGCATCAAG
CCTCTCTGCGACCTCCTCTCGTGCCCCGACAATAAGATCATCCAGGTGGCGCTCGACGGCCTCGAGAACATACTC
AAGATTGGCGATCTCGACAAGCAGTCTGCCGGCGAGGGCGCCGACTCGATCAACCGCTACGCCTTGTTCATTGAG
GAGTGCGGCGGCATGGAGAAGATTCACGAGTGCCAGAACAACGCCAACGAGGAGATCTACGTCAAGTCGTACCAC
ATCATCGAGAAGTACTTTTCAGACGACGCCGAGAACGACGAAGGCATGGTGCAGCCGGCTGGAGCTAATGGCACG
TTCGGCTTCGGTGCCAACGGTCCTGCTCAGTCGGGTGGCTTCAACTTTGCCAATGGCGGTGACTCGATGGACATG
Transcript >Ophio5|7018
ATGGCGGAGCGATATATCCCCGAGCATCGCCGGACGCAGTTCAAGGCCAAGAATACGTTCAAACCTGAGGAGCTG
CGTCGTCGTCGCGAGGAGCAGCAGGTTGAGATCCGCAAGGCAAAACGCGAAGAGAACCTGGCCAAGCGACGCGGC
ATCGGCACTGGTGAGAATCGTCCGGGCGCCTCGCTTGGCGCTGCCCCCGACAGTGACGATGAGTCGGCTCCCACG
GAGTCACAGTTAAACGAGGACCTGCCTCTGATGGTTCAGGGCGTCTTCTCGGAACAGATCGACCTCCAGATCCAA
GCCACCACCAAGTTCCGCAAACTCCTGTCCAAGGAGCGAAATCCCCCCATCGAAGAGGTCATCAAGACGGGCGTC
GTCAGCCGCTTCGTCGAATTCCTGCGCTCACCCCATACCCTCGTTCAGTTCGAGGCCGCCTGGGCGCTGACAAAC
ATCGCATCCGGCTCCGCCACCCAGACACAGGTGGTCATCGAGGCCGGCGCCGTGCCCATCTTTGTTGAGCTTCTA
GCCAGCCCGGAGCCTGATGTGCGGGAACAGGCCGTCTGGGCCCTCGGCAACATTGCCGGCGACAGTCCTCAGTGC
CGCGATTATGTGCTCAGCTGCGGCGCCTTGAAGCCCCTGCTGAACCTCCTCGGCGACAGCCGCAAGCTCAGCATG
CTGCGCAATGCCACCTGGACTCTGAGCAACTTTTGCCGTGGCAAGACGCCGCAGCCTGACTGGAACACGATTGCG
CCTGCCCTGGCGGTTCTCTCCAAGCTGGTTTACTCTCTGGATGACGAGGTCCTCATCGATGCTTGCTGGGCCATA
TCCTACTTGTCCGATGGCTCCAACGACAAAATCCAGGCCGTCATTGAGGCTGGCATTCCGCGCAGACTTGTTGAG
CTGCTGATGCACTCCTCGACGTCGGTCCAGACGCCCGCTCTGCGGTCCGTCGGCAACATCGTGACTGGTGACGAC
GTCCAGACGCAGGTCATCATCAACTGTGGCGCTCTGCCGTGCTTGCTGTCCCTCCTCAGCTCTACCAAGGATGGT
ATCCGCAAGGAGGCGTGCTGGACCATTTCCAACATAACGGCTGGCAACTCGTCTCAGATCCAGTCCGTCATCGAC
GCCAATATCATTCCGCCCCTCATTCACTTGCTCCAGAATGGCGACCTCAAGACGCGCAAGGAGGCTTGCTGGGCC
ATCAGTAATGCTACTTCGGGCGGACTCCAGAAGCCAGAGCAGATCCGGTATCTCGTCTCCCAGGGCTGCATCAAG
CCTCTCTGCGACCTCCTCTCGTGCCCCGACAATAAGATCATCCAGGTGGCGCTCGACGGCCTCGAGAACATACTC
AAGATTGGCGATCTCGACAAGCAGTCTGCCGGCGAGGGCGCCGACTCGATCAACCGCTACGCCTTGTTCATTGAG
GAGTGCGGCGGCATGGAGAAGATTCACGAGTGCCAGAACAACGCCAACGAGGAGATCTACGTCAAGTCGTACCAC
ATCATCGAGAAGTACTTTTCAGACGACGCCGAGAACGACGAAGGCATGGTGCAGCCGGCTGGAGCTAATGGCACG
TTCGGCTTCGGTGCCAACGGTCCTGCTCAGTCGGGTGGCTTCAACTTTGCCAATGGCGGTGACTCGATGGACATG
TAG
Gene >Ophio5|7018
ATGGCGGAGCGATATATCCCCGAGCATCGCCGGACGCAGTTCAAGGCCAAGAATACGTTCAAACCTGAGGAGCTG
CGTCGTCGTCGCGAGGAGCAGCAGGTTGAGATCCGCAAGGCAAAACGCGAAGAGAACCTGGCCAAGCGACGCGGC
ATCGGCACTGGTGAGAATCGTCCGGGCGCCTCGCTTGGCGCTGCCCCCGACAGTGACGATGAGTCGGCTCCCACG
GAGTCACAGGTATGTCGTGCTGAGTCTTCTCTGCGTTCTTTGTGTTTGCCTCATCCCCCCCCCCCCCTCTCCCCC
CCCTCCCCCCCCCCAAAAAAAAAACAGTTCGTTTCCACAGCGGCACCCTTACCCTCTGTGGGCTGCCCCCACACG
CCTGCACCGCAACGTCCTGGCCCTTGCTCGACGCTTTTCATTTGTATCCATTGCTGCATCACCTGGGCTGACGTT
CACGTGTCTAGTTAAACGAGGACCTGCCTCTGATGGTTCAGGGCGTCTTCTCGGAACAGATCGACCTCCAGATCC
AAGCCACCACCAAGTTCCGCAAACTCCTGTCCAAGGAGCGAAATCCCCCCATCGAAGAGGTCATCAAGACGGGCG
TCGTCAGCCGCTTCGTCGAATTCCTGCGCTCACCCCATACCCTCGTTCAGTTCGAGGCCGCCTGGGCGCTGACAA
ACATCGCATCCGGCTCCGCCACCCAGACACAGGTGGTCATCGAGGCCGGCGCCGTGCCCATCTTTGTTGAGCTTC
TAGCCAGCCCGGAGCCTGATGTGCGGGAACAGGCCGTCTGGGCCCTCGGCAACATTGCCGGCGACAGTCCTCAGT
GCCGCGATTATGTGCTCAGCTGCGGCGCCTTGAAGCCCCTGCTGAACCTCCTCGGCGACAGCCGCAAGCTCAGCA
TGCTGCGCAATGCCACCTGGACTCTGAGCAACTTTTGCCGTGGCAAGACGCCGCAGCCTGACTGGAACACGGTAA
AGTTCACCCTTCTCGACTTGACCCCTACTTGCAACGTCTGTTTCTAACCGAGAATTCATATCCACAGATTGCGCC
TGCCCTGGCGGTTCTCTCCAAGCTGGTTTACTCTCTGGATGACGAGGTCCTCATCGATGCTTGCTGGGCCATATC
CTACTTGTCCGATGGCTCCAACGACAAAATCCAGGCCGTCATTGAGGCTGGCATTCCGCGCAGACTTGTTGAGCT
GCTGATGCACTCCTCGACGTCGGTCCAGACGCCCGCTCTGCGGTCCGTCGGCAACATCGTGACTGGTGACGACGT
CCAGACGCAGGTCATCATCAACTGTGGCGCTCTGCCGTGCTTGCTGTCCCTCCTCAGCTCTACCAAGGATGGTAT
CCGCAAGGAGGCGTGCTGGACCATTTCCAACATAACGGCTGGCAACTCGTCTCAGATCCAGTCCGTCATCGACGC
CAATATCATTCCGCCCCTCATTCACTTGCTCCAGAATGGCGACCTCAAGACGCGCAAGGAGGCTTGCTGGGCCAT
CAGTAATGCTACTTCGGGCGGACTCCAGAAGCCAGAGCAGATCCGGTATCTCGTCTCCCAGGGCTGCATCAAGCC
TCTCTGCGACCTCCTCTCGTGCCCCGACAATAAGATCATCCAGGTGGCGCTCGACGGCCTCGAGAACATACTCAA
GATTGGCGATCTCGACAAGCAGTCTGCCGGCGAGGGCGCCGACTCGATCAACCGCTACGCCTTGTTCATTGAGGA
GTGCGGCGGCATGGAGAAGATTCACGAGTGCCAGAACAACGCCAACGAGGAGATCTACGTCAAGTCGTACCACAT
CATCGAGAAGTACTTTTCAGACGACGCCGAGAACGACGAAGGCATGGTGCAGCCGGCTGGAGCTAATGGCACGTT
CGGCTTCGGTGCCAACGGTCCTGCTCAGTCGGGTGGCTTCAACTTTGCCAATGGCGGTGACTCGATGGACATGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail