Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7004
Gene name
Locationscaffold_644:99..1543
Strand+
Gene length (bp)1444
Transcript length (bp)1155
Coding sequence length (bp)1152
Protein length (aa) 384

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 3.8E-25 76 260
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 5.5E-07 280 345

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 26 357 1.0E-65
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 13 352 4.0E-64
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 29 357 1.0E-63
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 29 357 7.0E-63
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 47 357 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 26 357 1.0E-65
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 13 352 4.0E-64
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 29 357 1.0E-63
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 29 357 7.0E-63
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 47 357 2.0E-61
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 31 362 2.0E-57
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 80 350 1.0E-56
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 32 350 2.0E-55
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 22 351 7.0E-40
sp|Q57891|Y449_METJA Uncharacterized transporter MJ0449 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0449 PE=3 SV=1 96 345 1.0E-10
sp|B1JQU5|FIEF_YERPY Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q1C296|FIEF_YERPA Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|B2JZA2|FIEF_YERPB Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q8ZJL7|FIEF_YERPE Cation-efflux pump FieF OS=Yersinia pestis GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|A9R6A2|FIEF_YERPG Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q1CD32|FIEF_YERPN Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|A4TSA8|FIEF_YERPP Cation-efflux pump FieF OS=Yersinia pestis (strain Pestoides F) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q66GA9|FIEF_YERPS Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|P21559|P34_RICRS Protein p34 OS=Rickettsia rickettsii (strain Sheila Smith) GN=p34 PE=3 SV=1 60 327 6.0E-08
sp|C0SP78|YDFM_BACSU Uncharacterized transporter YdfM OS=Bacillus subtilis (strain 168) GN=ydfM PE=3 SV=1 76 345 6.0E-08
sp|A1JHZ2|FIEF_YERE8 Cation-efflux pump FieF OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fieF PE=3 SV=1 69 331 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006811 ion transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1361 0.1498 0.1165 0.1185 0.0953 0.0557 0.6945 0.5751 0.5173 0.3996

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 97 119 22
3 140 162 22
4 177 199 22
5 235 257 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.16 0.00 0.58
CcL In ants, during behavior modification 2.35 0.00 4.79
CcD In ants, recently dead 9.21 2.77 15.65

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.126654 no
SC16a CcD 0.126654 no
CcL CcD 0.006824 yes

Orthologs

Orthofinder run ID4
Orthogroup260
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7911
Ophiocordyceps australis map64 (Brazil) OphauB2|4252
Ophiocordyceps camponoti-floridani Ophcf2|04607
Ophiocordyceps camponoti-floridani Ophcf2|04608
Ophiocordyceps camponoti-floridani Ophcf2|06095
Ophiocordyceps camponoti-rufipedis Ophun1|2880
Ophiocordyceps camponoti-rufipedis Ophun1|3880
Ophiocordyceps kimflemingae Ophio5|223
Ophiocordyceps kimflemingae Ophio5|7004 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10352

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7004
MTSISADHAPTLLDPDLLRRARLGDGVARRQGPVRKFYSRQDRLIDDYLRVEDEERVASDEEARLRPRIRFAVYG
SFIVNVGLFAIQLYAAVSTGSLSLFATAADAFMDLVSSSVMVITSRLARRPSIYRFPVGRTRIEPVGIIVFCALM
ATVSVELMIESARTLGQGHRDPAPLQPLPLALVGVAILSKSSLMVYCFFYRRFPSVRVFFLDHRNDIVVNVFGLI
MSIAGDRFAWYLDPIGAICIALLILCSWSSSAFEQAGLLAGKSAPRAYISKLIYVTLTHSSHILKVDTCRAYHAG
QNYYVEVDVVMDAETPLLISHDVGQSLQRKLEGLADVERAFVHIDYEHEHNIYEEHKPLYEKTESRSFRDRIRFC
KAAMFPRDA
Coding >Ophio5|7004
ATGACGTCCATCTCAGCGGATCACGCCCCGACGCTCCTCGATCCGGATCTCCTCCGCCGGGCTCGTCTCGGTGAT
GGTGTCGCCCGTCGCCAGGGCCCCGTTCGGAAGTTCTACTCGCGTCAGGATCGGCTTATTGATGACTATCTTCGT
GTGGAGGATGAGGAGCGGGTCGCGTCGGATGAGGAGGCTCGGCTTAGGCCGCGCATACGCTTTGCTGTCTACGGC
TCTTTCATCGTCAACGTCGGCCTTTTTGCTATACAGCTGTATGCTGCTGTTTCGACGGGCTCGCTGTCTCTCTTT
GCTACGGCTGCGGATGCCTTCATGGACCTCGTTTCGTCGTCTGTCATGGTCATTACTTCGCGTCTTGCTCGTCGA
CCGAGCATCTACCGCTTCCCTGTTGGCCGCACCCGTATCGAACCCGTCGGCATCATCGTCTTCTGTGCTCTCATG
GCCACCGTCTCCGTCGAGCTCATGATCGAATCCGCCCGGACCCTCGGCCAAGGCCACCGCGATCCTGCTCCCCTG
CAGCCCCTACCGCTGGCCCTCGTCGGCGTCGCCATCTTGTCCAAGAGTTCGCTGATGGTCTACTGCTTCTTCTAC
CGCCGCTTCCCCTCCGTCCGTGTCTTCTTCCTCGACCACCGCAACGACATTGTAGTCAACGTCTTCGGTCTCATC
ATGTCCATTGCCGGCGATCGCTTCGCCTGGTATCTCGATCCTATCGGCGCCATCTGCATCGCCCTTCTCATTCTC
TGCTCTTGGTCGTCCAGTGCCTTTGAGCAGGCTGGTCTACTTGCTGGCAAGAGTGCGCCGAGGGCGTACATCTCC
AAGCTCATCTACGTGACCCTGACGCATAGCAGCCACATCCTCAAGGTCGATACGTGCCGCGCCTATCACGCCGGA
CAAAACTACTACGTCGAGGTCGACGTAGTCATGGACGCGGAGACGCCCCTCCTCATCTCCCACGACGTCGGCCAG
TCGCTGCAGCGGAAGCTCGAGGGGCTGGCCGACGTAGAGAGGGCTTTCGTCCACATTGACTACGAGCACGAGCAT
AACATCTACGAGGAGCACAAGCCGCTCTACGAGAAGACCGAGTCGAGGAGTTTCAGGGACCGGATACGCTTCTGC
AAAGCGGCCATGTTCCCACGTGACGCC
Transcript >Ophio5|7004
ATGACGTCCATCTCAGCGGATCACGCCCCGACGCTCCTCGATCCGGATCTCCTCCGCCGGGCTCGTCTCGGTGAT
GGTGTCGCCCGTCGCCAGGGCCCCGTTCGGAAGTTCTACTCGCGTCAGGATCGGCTTATTGATGACTATCTTCGT
GTGGAGGATGAGGAGCGGGTCGCGTCGGATGAGGAGGCTCGGCTTAGGCCGCGCATACGCTTTGCTGTCTACGGC
TCTTTCATCGTCAACGTCGGCCTTTTTGCTATACAGCTGTATGCTGCTGTTTCGACGGGCTCGCTGTCTCTCTTT
GCTACGGCTGCGGATGCCTTCATGGACCTCGTTTCGTCGTCTGTCATGGTCATTACTTCGCGTCTTGCTCGTCGA
CCGAGCATCTACCGCTTCCCTGTTGGCCGCACCCGTATCGAACCCGTCGGCATCATCGTCTTCTGTGCTCTCATG
GCCACCGTCTCCGTCGAGCTCATGATCGAATCCGCCCGGACCCTCGGCCAAGGCCACCGCGATCCTGCTCCCCTG
CAGCCCCTACCGCTGGCCCTCGTCGGCGTCGCCATCTTGTCCAAGAGTTCGCTGATGGTCTACTGCTTCTTCTAC
CGCCGCTTCCCCTCCGTCCGTGTCTTCTTCCTCGACCACCGCAACGACATTGTAGTCAACGTCTTCGGTCTCATC
ATGTCCATTGCCGGCGATCGCTTCGCCTGGTATCTCGATCCTATCGGCGCCATCTGCATCGCCCTTCTCATTCTC
TGCTCTTGGTCGTCCAGTGCCTTTGAGCAGGCTGGTCTACTTGCTGGCAAGAGTGCGCCGAGGGCGTACATCTCC
AAGCTCATCTACGTGACCCTGACGCATAGCAGCCACATCCTCAAGGTCGATACGTGCCGCGCCTATCACGCCGGA
CAAAACTACTACGTCGAGGTCGACGTAGTCATGGACGCGGAGACGCCCCTCCTCATCTCCCACGACGTCGGCCAG
TCGCTGCAGCGGAAGCTCGAGGGGCTGGCCGACGTAGAGAGGGCTTTCGTCCACATTGACTACGAGCACGAGCAT
AACATCTACGAGGAGCACAAGCCGCTCTACGAGAAGACCGAGTCGAGGAGTTTCAGGGACCGGATACGCTTCTGC
AAAGCGGCCATGTTCCCACGTGACGCCTGA
Gene >Ophio5|7004
ATGACGTCCATCTCAGCGGATCACGCCCCGACGCTCCTCGATCCGGATCTCCTCCGCCGGGCTCGTCTCGGTGAT
GGTGTCGCCCGTCGCCAGGGCCCCGTTCGGAAGTTCTACTCGCGTCAGGATCGGCTTATTGATGACTATCTTCGT
GTGGAGGATGAGGAGCGGGTCGCGTCGGATGAGGAGGCTCGGCTTAGGCCGCGCATACGCTTTGCTGTCTACGGC
TCTTTCATCGTCAACGTCGGCCTTTTTGCTATACAGCTGTATGCTGCTGTTTCGACGGGCTCGCTGTCTGTAGGT
GGCTCGTTGTCGTGTCCTCTTTTTTTTTGTGTGCTGATGTCGTTGTAAGCTCTTTGCTACGGCTGCGGATGCCTT
CATGGACCTCGTTTCGTCGTCTGTCATGGTCATTACTTCGCGTCTTGCTCGTCGACCGAGCATCTACCGCTTCCC
TGTTGTCAGTGTCTTTTTCTCTACGAGAGCACACACACGCAGCTTCTTCTGACGCTCTCCTCCAGGGCCGCACCC
GTATCGAACCCGTCGGCATCATCGTCTTCTGTGCTCTCATGGCCACCGTCTCCGTCGAGCTCATGGTAAAAGAGG
CTCTTCCCGTCTCTCACCAATTTCATCTGCTCACCTGACAGATCGAATCCGCCCGGACCCTCGGCCAAGGCCACC
GCGATCCTGCTCCCCTGCAGCCCCTACCGCTGGCCCTCGTCGGCGTCGCCAGTACGTGTCTTAGGGTTACCCGAC
CTTCCTCCTCCCCACTGACGCCCGCTGGCCGCAGTCTTGTCCAAGAGTTCGCTGATGGTCTACTGCTTCTTCTAC
CGCCGCTTCCCCTCCGTCCGTGTCTTCTTCCTCGACCACCGCAACGACATTGTAGTCAACGTCTTCGGTCTCATC
ATGTCCATTGCCGGCGATCGCTTCGCCTGGTATCTCGATCCTATCGGCGCCATCTGCATCGCCCTTCTCATTCTC
TGCTCTTGGTCGTCCAGTGCCTTTGAGCAGGCTGGTCTACTTGCTGGCAAGAGTGCGCCGAGGGCGTACATCTCC
AAGCTCATCTACGTGACCCTGACGCATAGCAGCCACATCCTCAAGGTCGATACGGTCAGTCTTGGTTGCCTCGAT
GCCGGCCTCTCTCCTCTAACCCCCATTTTTTCCCTCGTCCCAGTGCCGCGCCTATCACGCCGGACAAAACTACTA
CGTCGAGGTCGACGTAGTCATGGACGCGGAGACGCCCCTCCTCATCTCCCACGACGTCGGCCAGTCGCTGCAGCG
GAAGCTCGAGGGGCTGGCCGACGTAGAGAGGGCTTTCGTCCACATTGACTACGAGCACGAGCATAACATCTACGA
GGAGCACAAGCCGCTCTACGAGAAGACCGAGTCGAGGAGTTTCAGGGACCGGATACGCTTCTGCAAAGCGGCCAT
GTTCCCACGTGACGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail