Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7004
Gene name
Locationscaffold_644:99..1543
Strand+
Gene length (bp)1444
Transcript length (bp)1155
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 3.8E-25 76 260
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 5.5E-07 280 345

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 26 357 1.0E-65
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 13 352 4.0E-64
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 29 357 1.0E-63
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 29 357 7.0E-63
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 47 357 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LDU0|MTP7_ORYSJ Metal tolerance protein 7 OS=Oryza sativa subsp. japonica GN=MTP7 PE=2 SV=1 26 357 1.0E-65
sp|Q10PP8|MTP4_ORYSJ Metal tolerance protein 4 OS=Oryza sativa subsp. japonica GN=MTP4 PE=2 SV=1 13 352 4.0E-64
sp|Q0WU02|MTP10_ARATH Metal tolerance protein 10 OS=Arabidopsis thaliana GN=MTP10 PE=2 SV=1 29 357 1.0E-63
sp|Q9SAJ7|MTP9_ARATH Metal tolerance protein 9 OS=Arabidopsis thaliana GN=MTP9 PE=2 SV=2 29 357 7.0E-63
sp|Q6Z7K5|MTP3_ORYSJ Metal tolerance protein 3 OS=Oryza sativa subsp. japonica GN=MTP3 PE=2 SV=1 47 357 2.0E-61
sp|Q5NA18|MTP5_ORYSJ Metal tolerance protein 5 OS=Oryza sativa subsp. japonica GN=MTP5 PE=2 SV=1 31 362 2.0E-57
sp|Q9M2P2|MTPC3_ARATH Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2 80 350 1.0E-56
sp|O80632|MTP11_ARATH Metal tolerance protein 11 OS=Arabidopsis thaliana GN=MTP11 PE=2 SV=1 32 350 2.0E-55
sp|Q0DHJ5|MTP6_ORYSJ Metal tolerance protein 6 OS=Oryza sativa subsp. japonica GN=MTP6 PE=2 SV=2 22 351 7.0E-40
sp|Q57891|Y449_METJA Uncharacterized transporter MJ0449 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0449 PE=3 SV=1 96 345 1.0E-10
sp|B1JQU5|FIEF_YERPY Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q1C296|FIEF_YERPA Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|B2JZA2|FIEF_YERPB Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q8ZJL7|FIEF_YERPE Cation-efflux pump FieF OS=Yersinia pestis GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|A9R6A2|FIEF_YERPG Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q1CD32|FIEF_YERPN Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|A4TSA8|FIEF_YERPP Cation-efflux pump FieF OS=Yersinia pestis (strain Pestoides F) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|Q66GA9|FIEF_YERPS Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fieF PE=3 SV=1 83 331 2.0E-08
sp|P21559|P34_RICRS Protein p34 OS=Rickettsia rickettsii (strain Sheila Smith) GN=p34 PE=3 SV=1 60 327 6.0E-08
sp|C0SP78|YDFM_BACSU Uncharacterized transporter YdfM OS=Bacillus subtilis (strain 168) GN=ydfM PE=3 SV=1 76 345 6.0E-08
sp|A1JHZ2|FIEF_YERE8 Cation-efflux pump FieF OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fieF PE=3 SV=1 69 331 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006812 cation transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 97 119 22
3 140 162 22
4 177 199 22
5 235 257 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7004
MTSISADHAPTLLDPDLLRRARLGDGVARRQGPVRKFYSRQDRLIDDYLRVEDEERVASDEEARLRPRIRFAVYG
SFIVNVGLFAIQLYAAVSTGSLSLFATAADAFMDLVSSSVMVITSRLARRPSIYRFPVGRTRIEPVGIIVFCALM
ATVSVELMIESARTLGQGHRDPAPLQPLPLALVGVAILSKSSLMVYCFFYRRFPSVRVFFLDHRNDIVVNVFGLI
MSIAGDRFAWYLDPIGAICIALLILCSWSSSAFEQAGLLAGKSAPRAYISKLIYVTLTHSSHILKVDTCRAYHAG
QNYYVEVDVVMDAETPLLISHDVGQSLQRKLEGLADVERAFVHIDYEHEHNIYEEHKPLYEKTESRSFRDRIRFC
KAAMFPRDA
Coding >Ophio5|7004
ATGACGTCCATCTCAGCGGATCACGCCCCGACGCTCCTCGATCCGGATCTCCTCCGCCGGGCTCGTCTCGGTGAT
GGTGTCGCCCGTCGCCAGGGCCCCGTTCGGAAGTTCTACTCGCGTCAGGATCGGCTTATTGATGACTATCTTCGT
GTGGAGGATGAGGAGCGGGTCGCGTCGGATGAGGAGGCTCGGCTTAGGCCGCGCATACGCTTTGCTGTCTACGGC
TCTTTCATCGTCAACGTCGGCCTTTTTGCTATACAGCTGTATGCTGCTGTTTCGACGGGCTCGCTGTCTCTCTTT
GCTACGGCTGCGGATGCCTTCATGGACCTCGTTTCGTCGTCTGTCATGGTCATTACTTCGCGTCTTGCTCGTCGA
CCGAGCATCTACCGCTTCCCTGTTGGCCGCACCCGTATCGAACCCGTCGGCATCATCGTCTTCTGTGCTCTCATG
GCCACCGTCTCCGTCGAGCTCATGATCGAATCCGCCCGGACCCTCGGCCAAGGCCACCGCGATCCTGCTCCCCTG
CAGCCCCTACCGCTGGCCCTCGTCGGCGTCGCCATCTTGTCCAAGAGTTCGCTGATGGTCTACTGCTTCTTCTAC
CGCCGCTTCCCCTCCGTCCGTGTCTTCTTCCTCGACCACCGCAACGACATTGTAGTCAACGTCTTCGGTCTCATC
ATGTCCATTGCCGGCGATCGCTTCGCCTGGTATCTCGATCCTATCGGCGCCATCTGCATCGCCCTTCTCATTCTC
TGCTCTTGGTCGTCCAGTGCCTTTGAGCAGGCTGGTCTACTTGCTGGCAAGAGTGCGCCGAGGGCGTACATCTCC
AAGCTCATCTACGTGACCCTGACGCATAGCAGCCACATCCTCAAGGTCGATACGTGCCGCGCCTATCACGCCGGA
CAAAACTACTACGTCGAGGTCGACGTAGTCATGGACGCGGAGACGCCCCTCCTCATCTCCCACGACGTCGGCCAG
TCGCTGCAGCGGAAGCTCGAGGGGCTGGCCGACGTAGAGAGGGCTTTCGTCCACATTGACTACGAGCACGAGCAT
AACATCTACGAGGAGCACAAGCCGCTCTACGAGAAGACCGAGTCGAGGAGTTTCAGGGACCGGATACGCTTCTGC
AAAGCGGCCATGTTCCCACGTGACGCC
Transcript >Ophio5|7004
ATGACGTCCATCTCAGCGGATCACGCCCCGACGCTCCTCGATCCGGATCTCCTCCGCCGGGCTCGTCTCGGTGAT
GGTGTCGCCCGTCGCCAGGGCCCCGTTCGGAAGTTCTACTCGCGTCAGGATCGGCTTATTGATGACTATCTTCGT
GTGGAGGATGAGGAGCGGGTCGCGTCGGATGAGGAGGCTCGGCTTAGGCCGCGCATACGCTTTGCTGTCTACGGC
TCTTTCATCGTCAACGTCGGCCTTTTTGCTATACAGCTGTATGCTGCTGTTTCGACGGGCTCGCTGTCTCTCTTT
GCTACGGCTGCGGATGCCTTCATGGACCTCGTTTCGTCGTCTGTCATGGTCATTACTTCGCGTCTTGCTCGTCGA
CCGAGCATCTACCGCTTCCCTGTTGGCCGCACCCGTATCGAACCCGTCGGCATCATCGTCTTCTGTGCTCTCATG
GCCACCGTCTCCGTCGAGCTCATGATCGAATCCGCCCGGACCCTCGGCCAAGGCCACCGCGATCCTGCTCCCCTG
CAGCCCCTACCGCTGGCCCTCGTCGGCGTCGCCATCTTGTCCAAGAGTTCGCTGATGGTCTACTGCTTCTTCTAC
CGCCGCTTCCCCTCCGTCCGTGTCTTCTTCCTCGACCACCGCAACGACATTGTAGTCAACGTCTTCGGTCTCATC
ATGTCCATTGCCGGCGATCGCTTCGCCTGGTATCTCGATCCTATCGGCGCCATCTGCATCGCCCTTCTCATTCTC
TGCTCTTGGTCGTCCAGTGCCTTTGAGCAGGCTGGTCTACTTGCTGGCAAGAGTGCGCCGAGGGCGTACATCTCC
AAGCTCATCTACGTGACCCTGACGCATAGCAGCCACATCCTCAAGGTCGATACGTGCCGCGCCTATCACGCCGGA
CAAAACTACTACGTCGAGGTCGACGTAGTCATGGACGCGGAGACGCCCCTCCTCATCTCCCACGACGTCGGCCAG
TCGCTGCAGCGGAAGCTCGAGGGGCTGGCCGACGTAGAGAGGGCTTTCGTCCACATTGACTACGAGCACGAGCAT
AACATCTACGAGGAGCACAAGCCGCTCTACGAGAAGACCGAGTCGAGGAGTTTCAGGGACCGGATACGCTTCTGC
AAAGCGGCCATGTTCCCACGTGACGCCTGA
Gene >Ophio5|7004
ATGACGTCCATCTCAGCGGATCACGCCCCGACGCTCCTCGATCCGGATCTCCTCCGCCGGGCTCGTCTCGGTGAT
GGTGTCGCCCGTCGCCAGGGCCCCGTTCGGAAGTTCTACTCGCGTCAGGATCGGCTTATTGATGACTATCTTCGT
GTGGAGGATGAGGAGCGGGTCGCGTCGGATGAGGAGGCTCGGCTTAGGCCGCGCATACGCTTTGCTGTCTACGGC
TCTTTCATCGTCAACGTCGGCCTTTTTGCTATACAGCTGTATGCTGCTGTTTCGACGGGCTCGCTGTCTGTAGGT
GGCTCGTTGTCGTGTCCTCTTTTTTTTTGTGTGCTGATGTCGTTGTAAGCTCTTTGCTACGGCTGCGGATGCCTT
CATGGACCTCGTTTCGTCGTCTGTCATGGTCATTACTTCGCGTCTTGCTCGTCGACCGAGCATCTACCGCTTCCC
TGTTGTCAGTGTCTTTTTCTCTACGAGAGCACACACACGCAGCTTCTTCTGACGCTCTCCTCCAGGGCCGCACCC
GTATCGAACCCGTCGGCATCATCGTCTTCTGTGCTCTCATGGCCACCGTCTCCGTCGAGCTCATGGTAAAAGAGG
CTCTTCCCGTCTCTCACCAATTTCATCTGCTCACCTGACAGATCGAATCCGCCCGGACCCTCGGCCAAGGCCACC
GCGATCCTGCTCCCCTGCAGCCCCTACCGCTGGCCCTCGTCGGCGTCGCCAGTACGTGTCTTAGGGTTACCCGAC
CTTCCTCCTCCCCACTGACGCCCGCTGGCCGCAGTCTTGTCCAAGAGTTCGCTGATGGTCTACTGCTTCTTCTAC
CGCCGCTTCCCCTCCGTCCGTGTCTTCTTCCTCGACCACCGCAACGACATTGTAGTCAACGTCTTCGGTCTCATC
ATGTCCATTGCCGGCGATCGCTTCGCCTGGTATCTCGATCCTATCGGCGCCATCTGCATCGCCCTTCTCATTCTC
TGCTCTTGGTCGTCCAGTGCCTTTGAGCAGGCTGGTCTACTTGCTGGCAAGAGTGCGCCGAGGGCGTACATCTCC
AAGCTCATCTACGTGACCCTGACGCATAGCAGCCACATCCTCAAGGTCGATACGGTCAGTCTTGGTTGCCTCGAT
GCCGGCCTCTCTCCTCTAACCCCCATTTTTTCCCTCGTCCCAGTGCCGCGCCTATCACGCCGGACAAAACTACTA
CGTCGAGGTCGACGTAGTCATGGACGCGGAGACGCCCCTCCTCATCTCCCACGACGTCGGCCAGTCGCTGCAGCG
GAAGCTCGAGGGGCTGGCCGACGTAGAGAGGGCTTTCGTCCACATTGACTACGAGCACGAGCATAACATCTACGA
GGAGCACAAGCCGCTCTACGAGAAGACCGAGTCGAGGAGTTTCAGGGACCGGATACGCTTCTGCAAAGCGGCCAT
GTTCCCACGTGACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail