Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7003
Gene name
Locationscaffold_643:8259..10710
Strand-
Gene length (bp)2451
Transcript length (bp)2073
Coding sequence length (bp)2070
Protein length (aa) 690

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 8.7E-23 288 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 273 620 1.0E-11
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 264 476 2.0E-09
sp|P15699|AMDR_EMENI Acetamidase regulatory protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=amdR PE=3 SV=2 180 474 2.0E-08
sp|Q9UTN0|YII3_SCHPO Uncharacterized transcriptional regulatory protein C139.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.03 PE=3 SV=1 277 462 4.0E-08
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 267 488 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 273 620 1.0E-11
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 264 476 2.0E-09
sp|P15699|AMDR_EMENI Acetamidase regulatory protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=amdR PE=3 SV=2 180 474 2.0E-08
sp|Q9UTN0|YII3_SCHPO Uncharacterized transcriptional regulatory protein C139.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.03 PE=3 SV=1 277 462 4.0E-08
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 267 488 1.0E-06
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 276 474 1.0E-06
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 220 474 2.0E-06
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 272 492 2.0E-06
sp|P08657|LAC9_KLULA Lactose regulatory protein LAC9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC9 PE=1 SV=1 290 505 7.0E-06
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 275 471 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7003
MPQLGQPLVRRRLRLPIQCLRTVRLSRRSLAPLTLSALLRPPLQARSPHLFIPSARPSVWLSAVQAEAVRTPMEL
HRGGRHNHHHHHQHTLHHTQRRQNEPSSTPASAVATAVAAAEAEYDGADSPRKKQKRNKPTLSCHELARRIASVL
RLTTLRISATGDGLIASLRQTECRYAYVANLLEETSRSAANGRRMTRPPKKKAAAERRPTIPNIADRGAIDDHDA
SSRGAVALSIGLLSHVPYSGTSASNVFGIGSEHPFANYWTCEGGLPEVISVLPEKAQADGLLARYFECVDPIYPM
IYRQTFYAEYEHFWQLASGQRDARDARDETDAAFVGLVFVMLALGTQFVTTTSAKERKQTAEFYASASNQALRLS
SYLSTASLCSIQAMVLITYFLINDNHASDGWAFAGILIRQAYAMGLHRDPNIVTPNASPFEKQQRRKVWQAVLLQ
DTFLTVLLSLPPSATHTDVSVDDLLDNSSSIASSDPTDTAYIRGSWMLANLVQETICSPRSLDMAICATARHKSK
LVAEFRAVYRSFPDVFRSWDGYSLTRLAATDKRIVRQTLFLSSNYFHNLMLVHASESPEVPVNVRGTLEAAHDAI
SAFFLFHSLLEPEARVWWVFNHRAFLEALCIGNVLREAAKEAGGIAVITRDPLFARARTDITRMMQIMELVGEDS
DVARTRVKILREFLE
Coding >Ophio5|7003
ATGCCCCAACTCGGTCAGCCTCTCGTTCGTCGTCGATTGCGCCTACCAATACAGTGTCTCCGTACTGTACGATTA
TCTCGACGCTCTCTCGCGCCTCTCACCCTATCTGCTCTCCTCCGCCCTCCGCTCCAAGCTCGGTCCCCTCATCTG
TTTATTCCCAGCGCCCGGCCATCTGTGTGGCTATCTGCTGTCCAGGCTGAGGCTGTCCGTACCCCGATGGAGCTG
CATCGCGGTGGCCGCCACAACCACCATCATCATCATCAACATACCCTTCACCATACACAGCGTCGTCAGAACGAA
CCATCGTCGACGCCCGCCTCCGCTGTCGCTACCGCCGTCGCTGCCGCAGAGGCCGAGTACGACGGCGCTGACAGT
CCCCGCAAGAAGCAGAAACGCAACAAGCCGACGCTGTCGTGCCACGAGCTGGCCAGGCGTATCGCATCAGTCCTT
CGGTTGACGACCTTGCGTATTAGTGCGACAGGGGACGGCCTCATTGCCTCGCTTCGCCAGACCGAGTGCCGCTAC
GCCTACGTCGCAAACCTCCTCGAAGAGACGTCGAGATCCGCAGCCAACGGCCGGCGCATGACCAGGCCGCCCAAG
AAAAAAGCCGCCGCCGAGAGGAGGCCGACGATCCCAAACATCGCCGACCGCGGCGCCATCGACGACCATGATGCC
TCGTCCCGCGGCGCCGTTGCCCTCTCCATTGGCCTCCTCTCTCACGTCCCCTACTCGGGAACATCGGCTAGCAAC
GTCTTCGGCATAGGCTCCGAGCACCCCTTTGCCAACTACTGGACCTGTGAGGGCGGCCTGCCCGAGGTCATCTCT
GTCCTCCCCGAAAAGGCCCAGGCCGATGGCCTACTGGCCCGCTACTTCGAGTGTGTCGACCCCATCTACCCAATG
ATCTATCGCCAGACCTTTTATGCCGAGTATGAGCACTTCTGGCAGCTGGCTTCGGGGCAGAGAGACGCGAGGGAC
GCGAGGGACGAGACGGACGCCGCCTTTGTCGGTCTCGTCTTCGTCATGTTGGCCCTCGGCACCCAGTTCGTCACG
ACGACGTCGGCCAAAGAGCGGAAGCAGACGGCCGAGTTTTACGCTTCGGCCAGCAATCAGGCCTTGCGCCTGTCG
TCGTACCTGAGCACGGCATCGCTCTGCTCCATTCAGGCCATGGTCCTCATAACCTACTTTCTCATCAACGACAAC
CACGCGTCCGACGGCTGGGCCTTTGCTGGCATCCTTATCCGGCAGGCATACGCCATGGGTCTACACCGTGATCCC
AACATCGTGACTCCCAACGCCAGCCCCTTTGAGAAGCAGCAGAGGCGCAAGGTGTGGCAGGCCGTACTGCTGCAG
GACACTTTCCTCACCGTGCTCCTGTCGCTGCCCCCCTCGGCGACGCACACGGACGTCTCGGTCGACGACCTGCTC
GACAACAGCTCGTCCATCGCCAGCAGCGATCCCACCGACACGGCCTACATCCGAGGCTCGTGGATGCTGGCCAAC
CTGGTACAGGAGACGATATGCTCACCGCGGTCGCTCGACATGGCCATCTGCGCCACGGCCCGCCACAAGTCGAAG
CTCGTGGCCGAGTTCAGAGCCGTGTACCGCTCGTTCCCGGACGTGTTCCGGTCGTGGGACGGCTACAGTCTGACG
AGGCTGGCCGCGACCGATAAGCGCATCGTACGACAGACGCTCTTCCTGTCGAGCAACTACTTCCATAACCTCATG
TTGGTGCACGCCTCGGAGAGCCCCGAGGTGCCCGTCAATGTGCGGGGTACGCTGGAGGCGGCTCATGATGCCATC
AGCGCCTTTTTCCTCTTTCACAGCCTGTTGGAGCCCGAGGCACGCGTCTGGTGGGTCTTTAACCACCGGGCCTTT
CTCGAGGCGCTGTGTATCGGCAATGTGCTTCGTGAGGCGGCCAAGGAGGCGGGGGGCATAGCCGTCATCACCCGT
GATCCTCTGTTCGCTCGGGCGAGGACCGACATCACGCGTATGATGCAGATCATGGAGCTTGTCGGAGAGGACTCG
GACGTTGCTAGGACACGAGTCAAGATTCTACGCGAGTTCCTGGAA
Transcript >Ophio5|7003
ATGCCCCAACTCGGTCAGCCTCTCGTTCGTCGTCGATTGCGCCTACCAATACAGTGTCTCCGTACTGTACGATTA
TCTCGACGCTCTCTCGCGCCTCTCACCCTATCTGCTCTCCTCCGCCCTCCGCTCCAAGCTCGGTCCCCTCATCTG
TTTATTCCCAGCGCCCGGCCATCTGTGTGGCTATCTGCTGTCCAGGCTGAGGCTGTCCGTACCCCGATGGAGCTG
CATCGCGGTGGCCGCCACAACCACCATCATCATCATCAACATACCCTTCACCATACACAGCGTCGTCAGAACGAA
CCATCGTCGACGCCCGCCTCCGCTGTCGCTACCGCCGTCGCTGCCGCAGAGGCCGAGTACGACGGCGCTGACAGT
CCCCGCAAGAAGCAGAAACGCAACAAGCCGACGCTGTCGTGCCACGAGCTGGCCAGGCGTATCGCATCAGTCCTT
CGGTTGACGACCTTGCGTATTAGTGCGACAGGGGACGGCCTCATTGCCTCGCTTCGCCAGACCGAGTGCCGCTAC
GCCTACGTCGCAAACCTCCTCGAAGAGACGTCGAGATCCGCAGCCAACGGCCGGCGCATGACCAGGCCGCCCAAG
AAAAAAGCCGCCGCCGAGAGGAGGCCGACGATCCCAAACATCGCCGACCGCGGCGCCATCGACGACCATGATGCC
TCGTCCCGCGGCGCCGTTGCCCTCTCCATTGGCCTCCTCTCTCACGTCCCCTACTCGGGAACATCGGCTAGCAAC
GTCTTCGGCATAGGCTCCGAGCACCCCTTTGCCAACTACTGGACCTGTGAGGGCGGCCTGCCCGAGGTCATCTCT
GTCCTCCCCGAAAAGGCCCAGGCCGATGGCCTACTGGCCCGCTACTTCGAGTGTGTCGACCCCATCTACCCAATG
ATCTATCGCCAGACCTTTTATGCCGAGTATGAGCACTTCTGGCAGCTGGCTTCGGGGCAGAGAGACGCGAGGGAC
GCGAGGGACGAGACGGACGCCGCCTTTGTCGGTCTCGTCTTCGTCATGTTGGCCCTCGGCACCCAGTTCGTCACG
ACGACGTCGGCCAAAGAGCGGAAGCAGACGGCCGAGTTTTACGCTTCGGCCAGCAATCAGGCCTTGCGCCTGTCG
TCGTACCTGAGCACGGCATCGCTCTGCTCCATTCAGGCCATGGTCCTCATAACCTACTTTCTCATCAACGACAAC
CACGCGTCCGACGGCTGGGCCTTTGCTGGCATCCTTATCCGGCAGGCATACGCCATGGGTCTACACCGTGATCCC
AACATCGTGACTCCCAACGCCAGCCCCTTTGAGAAGCAGCAGAGGCGCAAGGTGTGGCAGGCCGTACTGCTGCAG
GACACTTTCCTCACCGTGCTCCTGTCGCTGCCCCCCTCGGCGACGCACACGGACGTCTCGGTCGACGACCTGCTC
GACAACAGCTCGTCCATCGCCAGCAGCGATCCCACCGACACGGCCTACATCCGAGGCTCGTGGATGCTGGCCAAC
CTGGTACAGGAGACGATATGCTCACCGCGGTCGCTCGACATGGCCATCTGCGCCACGGCCCGCCACAAGTCGAAG
CTCGTGGCCGAGTTCAGAGCCGTGTACCGCTCGTTCCCGGACGTGTTCCGGTCGTGGGACGGCTACAGTCTGACG
AGGCTGGCCGCGACCGATAAGCGCATCGTACGACAGACGCTCTTCCTGTCGAGCAACTACTTCCATAACCTCATG
TTGGTGCACGCCTCGGAGAGCCCCGAGGTGCCCGTCAATGTGCGGGGTACGCTGGAGGCGGCTCATGATGCCATC
AGCGCCTTTTTCCTCTTTCACAGCCTGTTGGAGCCCGAGGCACGCGTCTGGTGGGTCTTTAACCACCGGGCCTTT
CTCGAGGCGCTGTGTATCGGCAATGTGCTTCGTGAGGCGGCCAAGGAGGCGGGGGGCATAGCCGTCATCACCCGT
GATCCTCTGTTCGCTCGGGCGAGGACCGACATCACGCGTATGATGCAGATCATGGAGCTTGTCGGAGAGGACTCG
GACGTTGCTAGGACACGAGTCAAGATTCTACGCGAGTTCCTGGAATGA
Gene >Ophio5|7003
ATGCCCCAACTCGGTCAGCCTCTCGTTCGTCGTCGATTGCGCCTACCAATACAGTGTCTCCGTACTGTACGATTA
TCTCGACGCTCTCTCGCGCCTCTCACCCTATCTGCTCTCCTCCGCCCTCCGCTCCAAGCTCGGTCCCCTCATCTG
TTTATTCCCAGCGCCCGGCCAGTGAGCCGACGGTCTTTCGTCTGAGACAGGCACTTATTCCCGGTTCAGTCTGTG
TGGCTATCTGCTGTCCAGGCTGAGGCTGTCCGTACCCCGATGGAGCTGCATCGCGGTGGCCGCCACAACCACCAT
CATCATCATCAACATACCCTTCACCATACACAGCGTCGTCAGAACGAACCATCGTCGACGCCCGCCTCCGCTGTC
GCTACCGCCGTCGCTGCCGCAGAGGCCGAGTACGACGGCGCTGACAGTCCCCGCAAGAAGCAGAAACGCAACAAG
CCGACGCTGTCGTGCCACGAGTGCGTCGAGAGGAAGACCAAGGTTGGTGTTTGACATGCTTGTTCCACCACAGGC
TGGCCAGGCGTATCGCATCAGTCCTTCGGTTGACGACCTTGCGTATTAGTGCGACAGGGGACGGCCTCATTGCCT
CGCTTGTAAGTCTTGCCGCCTCCTCTCGTCGCTTCTCCCGCTGACCAGAGCCTCTCACAGGCATTAAGCGCCAGA
CCGAGTGCCGCTACGCCTACGTCGCAAACCTCCTCGAGTGAGTAGCGCCCCGAGTCGCCCTCTATCGAAAACCGG
ACTCCTGGCGAGTTGACGCCGGAGCACAGAGAGACGTCGAGATCCGCAGCCAACGGCCGGCGCATGACCAGGCCG
CCCAAGAAAAAAGCCGCCGCCGAGAGGAGGCCGACGATCCCAAACATCGCCGACCGCGGCGCCATCGACGACCAT
GATGCCTCGTCCCGCGGCGCCGTTGCCCTCTCCATTGGCCTCCTCTCTCACGTCCCCTACTCGGGAACATCGGCT
AGCAACGTCTTCGGCATAGGCTCCGAGCACCCCTTTGCCAACTACTGGACCTGTGAGGGCGGCCTGCCCGAGGTC
ATCTCTGTCCTCCCCGAAAAGGCCCAGGCCGATGGCCTACTGGCCCGCTACTTCGAGTGTGTCGACCCCATCTAC
CCAATGATCTATCGCCAGACCTTTTATGCCGAGTATGAGCACTTCTGGCAGCTGGCTTCGGGGCAGAGAGACGCG
AGGGACGCGAGGGACGAGACGGACGCCGCCTTTGTCGGTCTCGTCTTCGTCATGTTGGCCCTCGGCACCCAGTTC
GTCACGACGACGTCGGCCAAAGAGCGGAAGCAGACGGCCGAGTTTTACGCTTCGGCCAGCAATCAGGCCTTGCGC
CTGTCGTCGTACCTGAGCACGGCATCGCTCTGCTCCATTCAGGCCATGGTCCTCATAACCTACTTTCTCATCAAC
GACAACCACGCGTCCGACGGCTGGGCCTTTGCTGGCATCCTTATCCGGCAGGCATACGCCATGGGTCTACACCGT
GATCCCAACATCGGTACGCTCCCTTTGTTCTCTCCTATGATCTTGGCCCCGGCTGACTGACGTCGGCTGGCGCGC
CACTCAATCCAGTGACTCCCAACGCCAGCCCCTTTGAGAAGCAGCAGAGGCGCAAGGTGTGGCAGGCCGTACTGC
TGCAGGACACTTTCCTCACCGTGCTCCTGTCGCTGCCCCCCTCGGCGACGCACACGGACGTCTCGGTCGACGACC
TGCTCGACAACAGCTCGTCCATCGCCAGCAGCGATCCCACCGACACGGCCTACATCCGAGGCTCGTGGATGCTGG
CCAACCTGGTACAGGAGACGATATGCTCACCGCGGTCGCTCGACATGGCCATCTGCGCCACGGCCCGCCACAAGT
CGAAGCTCGTGGCCGAGTTCAGAGCCGTGTACCGCTCGTTCCCGGACGTGTTCCGGTCGTGGGACGGCTACAGTC
TGACGAGGCTGGCCGCGACCGATAAGCGCATCGTACGACAGACGCTCTTCCTGTCGAGCAACTACTTCCATAACC
TCATGTTGGTGCACGCCTCGGAGAGCCCCGAGGTGCCCGTCAATGTGCGGGGTACGCTGGAGGCGGCTCATGATG
CCATCAGCGCCTTTTTCCTCTTTCACAGCCTGTTGGAGCCCGAGGCACGCGTCTGGTGGGTCTTTAACCACCGGG
CCTTTCTCGAGGCGCTGTGTATCGGCAATGTGCTTCGTGAGGCGGCCAAGGAGGCGGGGGGCATAGCCGTCATCA
CCCGTGATCCTCTGTTCGCTCGGGCGAGGACCGACATCAGTGAGTTCTCTTTCTCGCAGATGGGAAGAGGCTCGA
CGGCAAGCGGTTTACTGATGGTTGCGGACGACGATAGCGCGTATGATGCAGATCATGGAGCTTGTCGGAGAGGAC
TCGGACGTTGCTAGGACACGAGTCAAGATTCTACGCGAGTTCCTGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail