Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6991
Gene name
Locationscaffold_64:49953..51641
Strand+
Gene length (bp)1688
Transcript length (bp)1575
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.1E-31 48 415

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 23 434 2.0E-53
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 12 495 4.0E-53
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 27 459 1.0E-52
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 28 470 1.0E-51
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 23 427 6.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 23 434 2.0E-53
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 12 495 4.0E-53
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 27 459 1.0E-52
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 28 470 1.0E-51
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 23 427 6.0E-50
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 1 522 4.0E-48
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 12 522 1.0E-40
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 9 464 5.0E-35
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 21 430 8.0E-35
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 10 450 2.0E-31
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 4 477 4.0E-31
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 8 429 7.0E-31
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 26 522 2.0E-29
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 24 522 5.0E-27
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 32 510 3.0E-15
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 28 461 1.0E-14
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 1 435 4.0E-12
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 32 446 3.0E-11
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 27 253 2.0E-10
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 27 254 1.0E-09
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 36 249 7.0E-07
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 32 181 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 134 156 22
3 169 191 22
4 201 223 22
5 272 294 22
6 304 326 22
7 333 355 22
8 365 387 22
9 400 417 17
10 432 454 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 17.36 7.88 26.85
CcL In ants, during behavior modification 755.94 159.39 1352.50
CcD In ants, recently dead 340.97 137.95 543.99

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.020283 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6991
MAGSGKLVVAHDEASNRAGPSVEAVPLSDDDDRRICLKTDRVILSILVWVYFLQVLDKSVLAYGAAYGLKADTGL
TGNQYSLVCAAAPIAQLAWQPMSSYLIVRVPHRILMTALVLGWGIAQSASAACHNFSGLMAARFFLGLFEAGCLP
LFGIITSQWYRRAEQPLRIAAWYGTNGLATIFISLVSFGLGQIRSSTLRPWQIIFLFVGLVTVVSAPLVYWRLDN
DVHSARFLDQDEKLQALERLRANQTGTGSRAFDLSQIVEAAREPKTYLWFAMTLLLNIGASVTNAFGPLILDGLV
SDHSFTSLLNMPFGALQFIVILLASYLAQKAKLKGAVLALFMVPVVAGLAVLYAVRHDAAHQGALLAGYYLLACL
FGGNPLIVTWIIGNTAGSTKKSIVMSLYNAASAIGNIIGPLLFHEKDAPTYKPGLRACLAIFVTLVVVVLMQWTN
LVALNKMQETRRVRNGKPAKVVDHSMQQHFQVAGDGGSIQHVEIRVGDNNSRLPVDMTNSDLTDGQNDEFIYIY
Coding >Ophio5|6991
ATGGCTGGCTCCGGCAAGCTCGTCGTTGCTCACGATGAGGCTTCTAATCGGGCCGGACCCTCGGTCGAGGCGGTA
CCGCTTAGCGACGACGACGACAGACGAATCTGCCTCAAGACGGATCGCGTCATCCTCAGTATCCTTGTTTGGGTC
TATTTTCTTCAGGTGCTCGACAAGTCGGTGCTCGCGTATGGCGCTGCGTATGGCCTCAAGGCCGATACCGGCCTT
ACCGGTAACCAGTATTCGCTCGTTTGCGCGGCGGCGCCTATTGCCCAGCTGGCCTGGCAGCCCATGTCGTCGTAT
CTAATTGTCCGGGTACCGCATCGCATCCTCATGACTGCTCTCGTCCTCGGTTGGGGCATCGCCCAGTCGGCTTCG
GCCGCCTGTCACAACTTCTCCGGGCTCATGGCCGCCCGCTTCTTTCTCGGTTTGTTCGAGGCCGGCTGTCTTCCG
CTCTTTGGCATCATTACTAGTCAATGGTATCGTCGCGCCGAGCAGCCACTGCGTATCGCCGCCTGGTACGGCACG
AATGGCCTGGCTACCATCTTCATCTCGCTCGTGTCCTTTGGCCTCGGTCAGATTCGCTCCTCGACTCTCCGGCCG
TGGCAGATTATCTTCCTCTTCGTCGGCCTCGTCACCGTCGTCTCCGCGCCGTTGGTCTACTGGCGACTCGATAAT
GACGTCCACTCGGCCCGATTCCTCGATCAAGACGAAAAGCTTCAGGCGCTCGAGCGGCTGCGCGCCAATCAGACC
GGCACCGGCAGCCGGGCCTTTGACCTGAGCCAGATCGTCGAGGCCGCGCGTGAGCCCAAGACGTATCTCTGGTTT
GCCATGACGCTGCTACTCAACATCGGAGCCAGCGTGACCAACGCCTTTGGCCCTTTGATCCTCGACGGCCTTGTC
TCGGACCACAGCTTTACCAGCCTGCTTAACATGCCGTTTGGCGCCCTACAATTCATCGTCATCCTGCTGGCCAGC
TATCTCGCCCAAAAGGCCAAGCTCAAGGGCGCCGTCCTGGCCTTGTTCATGGTCCCCGTCGTTGCCGGCCTCGCC
GTCTTGTACGCTGTTCGTCACGACGCCGCGCACCAGGGCGCCCTCCTGGCCGGATACTACCTGCTTGCCTGTCTC
TTCGGAGGAAACCCGCTCATCGTCACCTGGATCATCGGCAATACCGCCGGTTCCACGAAAAAGTCCATCGTCATG
AGCCTCTACAACGCGGCCAGCGCCATCGGCAACATCATCGGTCCGCTACTCTTCCACGAAAAGGACGCGCCGACG
TATAAGCCTGGCTTGCGCGCCTGTCTGGCAATCTTTGTCACTCTCGTCGTCGTCGTCTTGATGCAGTGGACAAAC
TTGGTGGCCTTGAATAAGATGCAGGAGACGAGGCGAGTGCGCAACGGAAAGCCGGCCAAGGTCGTTGACCATTCT
ATGCAGCAGCACTTTCAAGTCGCCGGGGATGGTGGCAGTATTCAGCACGTCGAGATTCGGGTTGGCGACAACAAT
TCCAGGTTGCCGGTTGACATGACAAACTCGGACTTGACGGATGGCCAAAATGACGAGTTCATCTACATATAC
Transcript >Ophio5|6991
ATGGCTGGCTCCGGCAAGCTCGTCGTTGCTCACGATGAGGCTTCTAATCGGGCCGGACCCTCGGTCGAGGCGGTA
CCGCTTAGCGACGACGACGACAGACGAATCTGCCTCAAGACGGATCGCGTCATCCTCAGTATCCTTGTTTGGGTC
TATTTTCTTCAGGTGCTCGACAAGTCGGTGCTCGCGTATGGCGCTGCGTATGGCCTCAAGGCCGATACCGGCCTT
ACCGGTAACCAGTATTCGCTCGTTTGCGCGGCGGCGCCTATTGCCCAGCTGGCCTGGCAGCCCATGTCGTCGTAT
CTAATTGTCCGGGTACCGCATCGCATCCTCATGACTGCTCTCGTCCTCGGTTGGGGCATCGCCCAGTCGGCTTCG
GCCGCCTGTCACAACTTCTCCGGGCTCATGGCCGCCCGCTTCTTTCTCGGTTTGTTCGAGGCCGGCTGTCTTCCG
CTCTTTGGCATCATTACTAGTCAATGGTATCGTCGCGCCGAGCAGCCACTGCGTATCGCCGCCTGGTACGGCACG
AATGGCCTGGCTACCATCTTCATCTCGCTCGTGTCCTTTGGCCTCGGTCAGATTCGCTCCTCGACTCTCCGGCCG
TGGCAGATTATCTTCCTCTTCGTCGGCCTCGTCACCGTCGTCTCCGCGCCGTTGGTCTACTGGCGACTCGATAAT
GACGTCCACTCGGCCCGATTCCTCGATCAAGACGAAAAGCTTCAGGCGCTCGAGCGGCTGCGCGCCAATCAGACC
GGCACCGGCAGCCGGGCCTTTGACCTGAGCCAGATCGTCGAGGCCGCGCGTGAGCCCAAGACGTATCTCTGGTTT
GCCATGACGCTGCTACTCAACATCGGAGCCAGCGTGACCAACGCCTTTGGCCCTTTGATCCTCGACGGCCTTGTC
TCGGACCACAGCTTTACCAGCCTGCTTAACATGCCGTTTGGCGCCCTACAATTCATCGTCATCCTGCTGGCCAGC
TATCTCGCCCAAAAGGCCAAGCTCAAGGGCGCCGTCCTGGCCTTGTTCATGGTCCCCGTCGTTGCCGGCCTCGCC
GTCTTGTACGCTGTTCGTCACGACGCCGCGCACCAGGGCGCCCTCCTGGCCGGATACTACCTGCTTGCCTGTCTC
TTCGGAGGAAACCCGCTCATCGTCACCTGGATCATCGGCAATACCGCCGGTTCCACGAAAAAGTCCATCGTCATG
AGCCTCTACAACGCGGCCAGCGCCATCGGCAACATCATCGGTCCGCTACTCTTCCACGAAAAGGACGCGCCGACG
TATAAGCCTGGCTTGCGCGCCTGTCTGGCAATCTTTGTCACTCTCGTCGTCGTCGTCTTGATGCAGTGGACAAAC
TTGGTGGCCTTGAATAAGATGCAGGAGACGAGGCGAGTGCGCAACGGAAAGCCGGCCAAGGTCGTTGACCATTCT
ATGCAGCAGCACTTTCAAGTCGCCGGGGATGGTGGCAGTATTCAGCACGTCGAGATTCGGGTTGGCGACAACAAT
TCCAGGTTGCCGGTTGACATGACAAACTCGGACTTGACGGATGGCCAAAATGACGAGTTCATCTACATATACTGA
Gene >Ophio5|6991
ATGGCTGGCTCCGGCAAGCTCGTCGTTGCTCACGATGAGGCTTCTAATCGGGCCGGACCCTCGGTCGAGGCGGTA
CCGCTTAGCGACGACGACGACAGACGAATCTGCCTCAAGACGGATCGCGTCATCCTCAGTATCCTTGTTTGGGTC
TATTTTCTTCAGGTGCTCGACAAGTCGGTGCTCGCGTATGGCGCTGCGTATGGCCTCAAGGCCGATACCGGCCTT
ACCGGTAACCAGTATTCGCTCGTTTGCGCGGCGGCGCCTATTGCCCAGCTGGCCTGGCAGCCCATGTCGTCGTAT
CTAATTGTCCGGGTACCGCATCGCATCCTCATGACTGCTCTCGTCCTCGGTTGGGGCATCGCCCAGTCGGCTTCG
GCCGCCTGTCACAACTTCTCCGGGCTCATGGCCGCCCGCTTCTTTCTCGGTTTGTTCGAGGCCGGCTGTCTTCCG
CTCTTTGGCATCATTACTAGTCAATGGTATCGTCGCGCCGAGCAGCCACTGCGTATCGCCGCCTGGTACGGCACG
AATGGCCTGGCTACCATCTTCATCTCGCTCGTGTCCTTTGGCCTCGGTCAGATTCGCTCCTCGACTCTCCGGCCG
TGGCAGATGTGAGGAAAACACTCACTACCTTTTTACCCATCTTTCTTGATAGGCTAGCCGACTGACGTGGTGGGA
ATTAAACCAAAAAAAAAAATTTACATCATTAAAAATTTTAATTCAGTATCTTCCTCTTCGTCGGCCTCGTCACCG
TCGTCTCCGCGCCGTTGGTCTACTGGCGACTCGATAATGACGTCCACTCGGCCCGATTCCTCGATCAAGACGAAA
AGCTTCAGGCGCTCGAGCGGCTGCGCGCCAATCAGACCGGCACCGGCAGCCGGGCCTTTGACCTGAGCCAGATCG
TCGAGGCCGCGCGTGAGCCCAAGACGTATCTCTGGTTTGCCATGACGCTGCTACTCAACATCGGAGCCAGCGTGA
CCAACGCCTTTGGCCCTTTGATCCTCGACGGCCTTGTCTCGGACCACAGCTTTACCAGCCTGCTTAACATGCCGT
TTGGCGCCCTACAATTCATCGTCATCCTGCTGGCCAGCTATCTCGCCCAAAAGGCCAAGCTCAAGGGCGCCGTCC
TGGCCTTGTTCATGGTCCCCGTCGTTGCCGGCCTCGCCGTCTTGTACGCTGTTCGTCACGACGCCGCGCACCAGG
GCGCCCTCCTGGCCGGATACTACCTGCTTGCCTGTCTCTTCGGAGGAAACCCGCTCATCGTCACCTGGATCATCG
GCAATACCGCCGGTTCCACGAAAAAGTCCATCGTCATGAGCCTCTACAACGCGGCCAGCGCCATCGGCAACATCA
TCGGTCCGCTACTCTTCCACGAAAAGGACGCGCCGACGTATAAGCCTGGCTTGCGCGCCTGTCTGGCAATCTTTG
TCACTCTCGTCGTCGTCGTCTTGATGCAGTGGACAAACTTGGTGGCCTTGAATAAGATGCAGGAGACGAGGCGAG
TGCGCAACGGAAAGCCGGCCAAGGTCGTTGACCATTCTATGCAGCAGCACTTTCAAGTCGCCGGGGATGGTGGCA
GTATTCAGCACGTCGAGATTCGGGTTGGCGACAACAATTCCAGGTTGCCGGTTGACATGACAAACTCGGACTTGA
CGGATGGCCAAAATGACGAGTTCATCTACATATACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail