Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6991
Gene name
Locationscaffold_64:49953..51641
Strand+
Gene length (bp)1688
Transcript length (bp)1575
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.1E-31 48 415

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 23 434 2.0E-53
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 12 495 4.0E-53
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 27 459 1.0E-52
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 28 470 1.0E-51
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 23 427 6.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 23 434 2.0E-53
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 12 495 4.0E-53
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 27 459 1.0E-52
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 28 470 1.0E-51
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 23 427 6.0E-50
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 1 522 4.0E-48
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 12 522 1.0E-40
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 9 464 5.0E-35
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 21 430 8.0E-35
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 10 450 2.0E-31
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 4 477 4.0E-31
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 8 429 7.0E-31
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 26 522 2.0E-29
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 24 522 5.0E-27
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 32 510 3.0E-15
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 28 461 1.0E-14
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 1 435 4.0E-12
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 32 446 3.0E-11
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 27 253 2.0E-10
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 27 254 1.0E-09
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 36 249 7.0E-07
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 32 181 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 134 156 22
3 169 191 22
4 201 223 22
5 272 294 22
6 304 326 22
7 333 355 22
8 365 387 22
9 400 417 17
10 432 454 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6991
MAGSGKLVVAHDEASNRAGPSVEAVPLSDDDDRRICLKTDRVILSILVWVYFLQVLDKSVLAYGAAYGLKADTGL
TGNQYSLVCAAAPIAQLAWQPMSSYLIVRVPHRILMTALVLGWGIAQSASAACHNFSGLMAARFFLGLFEAGCLP
LFGIITSQWYRRAEQPLRIAAWYGTNGLATIFISLVSFGLGQIRSSTLRPWQIIFLFVGLVTVVSAPLVYWRLDN
DVHSARFLDQDEKLQALERLRANQTGTGSRAFDLSQIVEAAREPKTYLWFAMTLLLNIGASVTNAFGPLILDGLV
SDHSFTSLLNMPFGALQFIVILLASYLAQKAKLKGAVLALFMVPVVAGLAVLYAVRHDAAHQGALLAGYYLLACL
FGGNPLIVTWIIGNTAGSTKKSIVMSLYNAASAIGNIIGPLLFHEKDAPTYKPGLRACLAIFVTLVVVVLMQWTN
LVALNKMQETRRVRNGKPAKVVDHSMQQHFQVAGDGGSIQHVEIRVGDNNSRLPVDMTNSDLTDGQNDEFIYIY
Coding >Ophio5|6991
ATGGCTGGCTCCGGCAAGCTCGTCGTTGCTCACGATGAGGCTTCTAATCGGGCCGGACCCTCGGTCGAGGCGGTA
CCGCTTAGCGACGACGACGACAGACGAATCTGCCTCAAGACGGATCGCGTCATCCTCAGTATCCTTGTTTGGGTC
TATTTTCTTCAGGTGCTCGACAAGTCGGTGCTCGCGTATGGCGCTGCGTATGGCCTCAAGGCCGATACCGGCCTT
ACCGGTAACCAGTATTCGCTCGTTTGCGCGGCGGCGCCTATTGCCCAGCTGGCCTGGCAGCCCATGTCGTCGTAT
CTAATTGTCCGGGTACCGCATCGCATCCTCATGACTGCTCTCGTCCTCGGTTGGGGCATCGCCCAGTCGGCTTCG
GCCGCCTGTCACAACTTCTCCGGGCTCATGGCCGCCCGCTTCTTTCTCGGTTTGTTCGAGGCCGGCTGTCTTCCG
CTCTTTGGCATCATTACTAGTCAATGGTATCGTCGCGCCGAGCAGCCACTGCGTATCGCCGCCTGGTACGGCACG
AATGGCCTGGCTACCATCTTCATCTCGCTCGTGTCCTTTGGCCTCGGTCAGATTCGCTCCTCGACTCTCCGGCCG
TGGCAGATTATCTTCCTCTTCGTCGGCCTCGTCACCGTCGTCTCCGCGCCGTTGGTCTACTGGCGACTCGATAAT
GACGTCCACTCGGCCCGATTCCTCGATCAAGACGAAAAGCTTCAGGCGCTCGAGCGGCTGCGCGCCAATCAGACC
GGCACCGGCAGCCGGGCCTTTGACCTGAGCCAGATCGTCGAGGCCGCGCGTGAGCCCAAGACGTATCTCTGGTTT
GCCATGACGCTGCTACTCAACATCGGAGCCAGCGTGACCAACGCCTTTGGCCCTTTGATCCTCGACGGCCTTGTC
TCGGACCACAGCTTTACCAGCCTGCTTAACATGCCGTTTGGCGCCCTACAATTCATCGTCATCCTGCTGGCCAGC
TATCTCGCCCAAAAGGCCAAGCTCAAGGGCGCCGTCCTGGCCTTGTTCATGGTCCCCGTCGTTGCCGGCCTCGCC
GTCTTGTACGCTGTTCGTCACGACGCCGCGCACCAGGGCGCCCTCCTGGCCGGATACTACCTGCTTGCCTGTCTC
TTCGGAGGAAACCCGCTCATCGTCACCTGGATCATCGGCAATACCGCCGGTTCCACGAAAAAGTCCATCGTCATG
AGCCTCTACAACGCGGCCAGCGCCATCGGCAACATCATCGGTCCGCTACTCTTCCACGAAAAGGACGCGCCGACG
TATAAGCCTGGCTTGCGCGCCTGTCTGGCAATCTTTGTCACTCTCGTCGTCGTCGTCTTGATGCAGTGGACAAAC
TTGGTGGCCTTGAATAAGATGCAGGAGACGAGGCGAGTGCGCAACGGAAAGCCGGCCAAGGTCGTTGACCATTCT
ATGCAGCAGCACTTTCAAGTCGCCGGGGATGGTGGCAGTATTCAGCACGTCGAGATTCGGGTTGGCGACAACAAT
TCCAGGTTGCCGGTTGACATGACAAACTCGGACTTGACGGATGGCCAAAATGACGAGTTCATCTACATATAC
Transcript >Ophio5|6991
ATGGCTGGCTCCGGCAAGCTCGTCGTTGCTCACGATGAGGCTTCTAATCGGGCCGGACCCTCGGTCGAGGCGGTA
CCGCTTAGCGACGACGACGACAGACGAATCTGCCTCAAGACGGATCGCGTCATCCTCAGTATCCTTGTTTGGGTC
TATTTTCTTCAGGTGCTCGACAAGTCGGTGCTCGCGTATGGCGCTGCGTATGGCCTCAAGGCCGATACCGGCCTT
ACCGGTAACCAGTATTCGCTCGTTTGCGCGGCGGCGCCTATTGCCCAGCTGGCCTGGCAGCCCATGTCGTCGTAT
CTAATTGTCCGGGTACCGCATCGCATCCTCATGACTGCTCTCGTCCTCGGTTGGGGCATCGCCCAGTCGGCTTCG
GCCGCCTGTCACAACTTCTCCGGGCTCATGGCCGCCCGCTTCTTTCTCGGTTTGTTCGAGGCCGGCTGTCTTCCG
CTCTTTGGCATCATTACTAGTCAATGGTATCGTCGCGCCGAGCAGCCACTGCGTATCGCCGCCTGGTACGGCACG
AATGGCCTGGCTACCATCTTCATCTCGCTCGTGTCCTTTGGCCTCGGTCAGATTCGCTCCTCGACTCTCCGGCCG
TGGCAGATTATCTTCCTCTTCGTCGGCCTCGTCACCGTCGTCTCCGCGCCGTTGGTCTACTGGCGACTCGATAAT
GACGTCCACTCGGCCCGATTCCTCGATCAAGACGAAAAGCTTCAGGCGCTCGAGCGGCTGCGCGCCAATCAGACC
GGCACCGGCAGCCGGGCCTTTGACCTGAGCCAGATCGTCGAGGCCGCGCGTGAGCCCAAGACGTATCTCTGGTTT
GCCATGACGCTGCTACTCAACATCGGAGCCAGCGTGACCAACGCCTTTGGCCCTTTGATCCTCGACGGCCTTGTC
TCGGACCACAGCTTTACCAGCCTGCTTAACATGCCGTTTGGCGCCCTACAATTCATCGTCATCCTGCTGGCCAGC
TATCTCGCCCAAAAGGCCAAGCTCAAGGGCGCCGTCCTGGCCTTGTTCATGGTCCCCGTCGTTGCCGGCCTCGCC
GTCTTGTACGCTGTTCGTCACGACGCCGCGCACCAGGGCGCCCTCCTGGCCGGATACTACCTGCTTGCCTGTCTC
TTCGGAGGAAACCCGCTCATCGTCACCTGGATCATCGGCAATACCGCCGGTTCCACGAAAAAGTCCATCGTCATG
AGCCTCTACAACGCGGCCAGCGCCATCGGCAACATCATCGGTCCGCTACTCTTCCACGAAAAGGACGCGCCGACG
TATAAGCCTGGCTTGCGCGCCTGTCTGGCAATCTTTGTCACTCTCGTCGTCGTCGTCTTGATGCAGTGGACAAAC
TTGGTGGCCTTGAATAAGATGCAGGAGACGAGGCGAGTGCGCAACGGAAAGCCGGCCAAGGTCGTTGACCATTCT
ATGCAGCAGCACTTTCAAGTCGCCGGGGATGGTGGCAGTATTCAGCACGTCGAGATTCGGGTTGGCGACAACAAT
TCCAGGTTGCCGGTTGACATGACAAACTCGGACTTGACGGATGGCCAAAATGACGAGTTCATCTACATATACTGA
Gene >Ophio5|6991
ATGGCTGGCTCCGGCAAGCTCGTCGTTGCTCACGATGAGGCTTCTAATCGGGCCGGACCCTCGGTCGAGGCGGTA
CCGCTTAGCGACGACGACGACAGACGAATCTGCCTCAAGACGGATCGCGTCATCCTCAGTATCCTTGTTTGGGTC
TATTTTCTTCAGGTGCTCGACAAGTCGGTGCTCGCGTATGGCGCTGCGTATGGCCTCAAGGCCGATACCGGCCTT
ACCGGTAACCAGTATTCGCTCGTTTGCGCGGCGGCGCCTATTGCCCAGCTGGCCTGGCAGCCCATGTCGTCGTAT
CTAATTGTCCGGGTACCGCATCGCATCCTCATGACTGCTCTCGTCCTCGGTTGGGGCATCGCCCAGTCGGCTTCG
GCCGCCTGTCACAACTTCTCCGGGCTCATGGCCGCCCGCTTCTTTCTCGGTTTGTTCGAGGCCGGCTGTCTTCCG
CTCTTTGGCATCATTACTAGTCAATGGTATCGTCGCGCCGAGCAGCCACTGCGTATCGCCGCCTGGTACGGCACG
AATGGCCTGGCTACCATCTTCATCTCGCTCGTGTCCTTTGGCCTCGGTCAGATTCGCTCCTCGACTCTCCGGCCG
TGGCAGATGTGAGGAAAACACTCACTACCTTTTTACCCATCTTTCTTGATAGGCTAGCCGACTGACGTGGTGGGA
ATTAAACCAAAAAAAAAAATTTACATCATTAAAAATTTTAATTCAGTATCTTCCTCTTCGTCGGCCTCGTCACCG
TCGTCTCCGCGCCGTTGGTCTACTGGCGACTCGATAATGACGTCCACTCGGCCCGATTCCTCGATCAAGACGAAA
AGCTTCAGGCGCTCGAGCGGCTGCGCGCCAATCAGACCGGCACCGGCAGCCGGGCCTTTGACCTGAGCCAGATCG
TCGAGGCCGCGCGTGAGCCCAAGACGTATCTCTGGTTTGCCATGACGCTGCTACTCAACATCGGAGCCAGCGTGA
CCAACGCCTTTGGCCCTTTGATCCTCGACGGCCTTGTCTCGGACCACAGCTTTACCAGCCTGCTTAACATGCCGT
TTGGCGCCCTACAATTCATCGTCATCCTGCTGGCCAGCTATCTCGCCCAAAAGGCCAAGCTCAAGGGCGCCGTCC
TGGCCTTGTTCATGGTCCCCGTCGTTGCCGGCCTCGCCGTCTTGTACGCTGTTCGTCACGACGCCGCGCACCAGG
GCGCCCTCCTGGCCGGATACTACCTGCTTGCCTGTCTCTTCGGAGGAAACCCGCTCATCGTCACCTGGATCATCG
GCAATACCGCCGGTTCCACGAAAAAGTCCATCGTCATGAGCCTCTACAACGCGGCCAGCGCCATCGGCAACATCA
TCGGTCCGCTACTCTTCCACGAAAAGGACGCGCCGACGTATAAGCCTGGCTTGCGCGCCTGTCTGGCAATCTTTG
TCACTCTCGTCGTCGTCGTCTTGATGCAGTGGACAAACTTGGTGGCCTTGAATAAGATGCAGGAGACGAGGCGAG
TGCGCAACGGAAAGCCGGCCAAGGTCGTTGACCATTCTATGCAGCAGCACTTTCAAGTCGCCGGGGATGGTGGCA
GTATTCAGCACGTCGAGATTCGGGTTGGCGACAACAATTCCAGGTTGCCGGTTGACATGACAAACTCGGACTTGA
CGGATGGCCAAAATGACGAGTTCATCTACATATACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail