Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6987
Gene name
Locationscaffold_64:42895..44254
Strand-
Gene length (bp)1359
Transcript length (bp)1359
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16483 Glyco_hydro_64 Beta-1,3-glucanase 4.6E-121 74 447

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 149 423 3.0E-14
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 149 423 4.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6987
MVRLKSATCLLGAASATLALRNRGLGAFSVVKPGGVEDVVVTEDNIMTGSFHGNRTIVVHQNRARNNGSDDKPSL
TLEFVNLYNTTQTINAYVTGLDASNRVVIVRADGSLLYPSSGGSETPVPIKESVKIPLMERSKRMPLAMALYGGR
IWFAEGELQFYMVKTPYGDGMVQPSAMNLRDPSAGVNWSFAELTYTRERSVFANISYVDFVGLILSMALRERNNR
PLQMVRGLNTDAVSKICSGMVSQSGRDGYPWSRLCVADGSGTPIRVMSPNSFGVVSPGDFDQYWTSYVDRVWEQY
RQTPLMVDTQSAAGQVECRVSDNTLRCGGGDNRGYSKPTAQDIWGCNSGPFERLADDNPVHVAVIPRLCAAFVRS
TLLLAGGDVQPRLGASHYYQDTPASHYSRLIHELELDGRGYAFPYDDVNPAGEVDASGLVASDQPDVLTVYVGVP
PK
Coding >Ophio5|6987
ATGGTGCGGCTAAAGTCGGCGACCTGTCTTCTCGGAGCGGCGTCAGCGACGCTGGCCCTGCGCAACCGGGGCCTC
GGCGCCTTCAGCGTGGTGAAGCCGGGCGGCGTCGAGGACGTGGTGGTGACAGAGGACAACATCATGACGGGCAGC
TTTCACGGCAACAGGACGATCGTGGTGCACCAAAACAGAGCGCGCAACAATGGTTCCGACGACAAGCCGTCATTG
ACGCTCGAATTCGTCAACCTGTACAACACGACGCAGACGATCAACGCCTACGTGACGGGTCTCGATGCCTCGAAT
CGCGTCGTCATCGTCCGGGCGGACGGCAGCCTGCTATACCCGAGCTCGGGCGGGTCCGAGACGCCCGTGCCCATC
AAGGAGAGCGTGAAGATTCCGCTGATGGAAAGATCTAAGCGGATGCCCTTGGCGATGGCGCTGTACGGCGGGCGC
ATCTGGTTCGCCGAGGGGGAGCTGCAGTTTTACATGGTCAAGACGCCGTACGGTGACGGCATGGTGCAGCCGTCA
GCGATGAATCTTCGGGACCCGAGCGCGGGCGTCAACTGGAGCTTCGCGGAGTTGACGTACACGCGAGAGCGCAGC
GTCTTCGCCAACATCAGCTACGTCGACTTTGTCGGGCTCATCCTGAGCATGGCGCTGCGGGAGAGGAACAACCGG
CCGCTGCAGATGGTCCGCGGGCTCAACACGGATGCCGTGTCCAAGATCTGCTCGGGCATGGTCAGCCAATCCGGG
CGCGATGGCTACCCCTGGAGTCGGCTTTGCGTGGCCGACGGCAGCGGGACGCCGATCCGGGTCATGTCCCCCAAC
AGCTTCGGGGTTGTCAGCCCGGGCGACTTTGACCAGTACTGGACGTCGTACGTGGATCGGGTGTGGGAGCAATAC
CGGCAGACGCCGCTCATGGTCGACACGCAGTCGGCGGCCGGGCAGGTCGAGTGCCGGGTCTCGGACAACACGCTG
CGCTGCGGCGGAGGCGACAACCGCGGCTACAGCAAGCCGACGGCGCAGGACATATGGGGCTGCAACAGCGGGCCC
TTTGAGCGACTGGCCGATGATAATCCCGTGCACGTGGCCGTGATCCCGCGGCTCTGTGCCGCCTTTGTCCGGTCG
ACGCTTCTGCTGGCCGGGGGCGACGTCCAGCCGCGGCTCGGCGCGTCGCACTACTACCAAGACACGCCGGCCAGC
CACTACAGCCGGCTAATTCACGAGCTGGAGCTGGACGGCAGGGGTTACGCGTTTCCCTACGACGACGTGAACCCT
GCCGGCGAGGTGGACGCGTCGGGCCTCGTTGCGTCGGACCAGCCAGATGTGCTGACGGTGTACGTTGGGGTGCCA
CCCAAG
Transcript >Ophio5|6987
ATGGTGCGGCTAAAGTCGGCGACCTGTCTTCTCGGAGCGGCGTCAGCGACGCTGGCCCTGCGCAACCGGGGCCTC
GGCGCCTTCAGCGTGGTGAAGCCGGGCGGCGTCGAGGACGTGGTGGTGACAGAGGACAACATCATGACGGGCAGC
TTTCACGGCAACAGGACGATCGTGGTGCACCAAAACAGAGCGCGCAACAATGGTTCCGACGACAAGCCGTCATTG
ACGCTCGAATTCGTCAACCTGTACAACACGACGCAGACGATCAACGCCTACGTGACGGGTCTCGATGCCTCGAAT
CGCGTCGTCATCGTCCGGGCGGACGGCAGCCTGCTATACCCGAGCTCGGGCGGGTCCGAGACGCCCGTGCCCATC
AAGGAGAGCGTGAAGATTCCGCTGATGGAAAGATCTAAGCGGATGCCCTTGGCGATGGCGCTGTACGGCGGGCGC
ATCTGGTTCGCCGAGGGGGAGCTGCAGTTTTACATGGTCAAGACGCCGTACGGTGACGGCATGGTGCAGCCGTCA
GCGATGAATCTTCGGGACCCGAGCGCGGGCGTCAACTGGAGCTTCGCGGAGTTGACGTACACGCGAGAGCGCAGC
GTCTTCGCCAACATCAGCTACGTCGACTTTGTCGGGCTCATCCTGAGCATGGCGCTGCGGGAGAGGAACAACCGG
CCGCTGCAGATGGTCCGCGGGCTCAACACGGATGCCGTGTCCAAGATCTGCTCGGGCATGGTCAGCCAATCCGGG
CGCGATGGCTACCCCTGGAGTCGGCTTTGCGTGGCCGACGGCAGCGGGACGCCGATCCGGGTCATGTCCCCCAAC
AGCTTCGGGGTTGTCAGCCCGGGCGACTTTGACCAGTACTGGACGTCGTACGTGGATCGGGTGTGGGAGCAATAC
CGGCAGACGCCGCTCATGGTCGACACGCAGTCGGCGGCCGGGCAGGTCGAGTGCCGGGTCTCGGACAACACGCTG
CGCTGCGGCGGAGGCGACAACCGCGGCTACAGCAAGCCGACGGCGCAGGACATATGGGGCTGCAACAGCGGGCCC
TTTGAGCGACTGGCCGATGATAATCCCGTGCACGTGGCCGTGATCCCGCGGCTCTGTGCCGCCTTTGTCCGGTCG
ACGCTTCTGCTGGCCGGGGGCGACGTCCAGCCGCGGCTCGGCGCGTCGCACTACTACCAAGACACGCCGGCCAGC
CACTACAGCCGGCTAATTCACGAGCTGGAGCTGGACGGCAGGGGTTACGCGTTTCCCTACGACGACGTGAACCCT
GCCGGCGAGGTGGACGCGTCGGGCCTCGTTGCGTCGGACCAGCCAGATGTGCTGACGGTGTACGTTGGGGTGCCA
CCCAAGTGA
Gene >Ophio5|6987
ATGGTGCGGCTAAAGTCGGCGACCTGTCTTCTCGGAGCGGCGTCAGCGACGCTGGCCCTGCGCAACCGGGGCCTC
GGCGCCTTCAGCGTGGTGAAGCCGGGCGGCGTCGAGGACGTGGTGGTGACAGAGGACAACATCATGACGGGCAGC
TTTCACGGCAACAGGACGATCGTGGTGCACCAAAACAGAGCGCGCAACAATGGTTCCGACGACAAGCCGTCATTG
ACGCTCGAATTCGTCAACCTGTACAACACGACGCAGACGATCAACGCCTACGTGACGGGTCTCGATGCCTCGAAT
CGCGTCGTCATCGTCCGGGCGGACGGCAGCCTGCTATACCCGAGCTCGGGCGGGTCCGAGACGCCCGTGCCCATC
AAGGAGAGCGTGAAGATTCCGCTGATGGAAAGATCTAAGCGGATGCCCTTGGCGATGGCGCTGTACGGCGGGCGC
ATCTGGTTCGCCGAGGGGGAGCTGCAGTTTTACATGGTCAAGACGCCGTACGGTGACGGCATGGTGCAGCCGTCA
GCGATGAATCTTCGGGACCCGAGCGCGGGCGTCAACTGGAGCTTCGCGGAGTTGACGTACACGCGAGAGCGCAGC
GTCTTCGCCAACATCAGCTACGTCGACTTTGTCGGGCTCATCCTGAGCATGGCGCTGCGGGAGAGGAACAACCGG
CCGCTGCAGATGGTCCGCGGGCTCAACACGGATGCCGTGTCCAAGATCTGCTCGGGCATGGTCAGCCAATCCGGG
CGCGATGGCTACCCCTGGAGTCGGCTTTGCGTGGCCGACGGCAGCGGGACGCCGATCCGGGTCATGTCCCCCAAC
AGCTTCGGGGTTGTCAGCCCGGGCGACTTTGACCAGTACTGGACGTCGTACGTGGATCGGGTGTGGGAGCAATAC
CGGCAGACGCCGCTCATGGTCGACACGCAGTCGGCGGCCGGGCAGGTCGAGTGCCGGGTCTCGGACAACACGCTG
CGCTGCGGCGGAGGCGACAACCGCGGCTACAGCAAGCCGACGGCGCAGGACATATGGGGCTGCAACAGCGGGCCC
TTTGAGCGACTGGCCGATGATAATCCCGTGCACGTGGCCGTGATCCCGCGGCTCTGTGCCGCCTTTGTCCGGTCG
ACGCTTCTGCTGGCCGGGGGCGACGTCCAGCCGCGGCTCGGCGCGTCGCACTACTACCAAGACACGCCGGCCAGC
CACTACAGCCGGCTAATTCACGAGCTGGAGCTGGACGGCAGGGGTTACGCGTTTCCCTACGACGACGTGAACCCT
GCCGGCGAGGTGGACGCGTCGGGCCTCGTTGCGTCGGACCAGCCAGATGTGCTGACGGTGTACGTTGGGGTGCCA
CCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail