Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6981
Gene name
Locationscaffold_64:31774..32919
Strand-
Gene length (bp)1145
Transcript length (bp)1092
Coding sequence length (bp)1089
Protein length (aa) 363

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.8E-29 104 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 89 350 3.0E-38
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 89 350 4.0E-38
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 61 350 2.0E-34
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 88 350 1.0E-32
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 88 351 4.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 89 350 3.0E-38
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 89 350 4.0E-38
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 61 350 2.0E-34
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 88 350 1.0E-32
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 88 351 4.0E-32
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 89 350 6.0E-32
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 62 350 2.0E-31
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 89 350 3.0E-30
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 89 350 1.0E-29
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 90 350 6.0E-29
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 88 350 9.0E-29
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 88 350 9.0E-29
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 74 350 1.0E-27
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 88 350 1.0E-27
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 88 350 3.0E-27
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 89 350 3.0E-27
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 89 350 6.0E-27
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 74 350 6.0E-27
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 86 350 2.0E-26
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 90 350 1.0E-25
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 89 350 4.0E-25
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 141 352 1.0E-18
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 118 301 1.0E-10
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 118 335 3.0E-10
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 118 335 7.0E-10
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 118 335 8.0E-10
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 118 335 1.0E-09
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 118 335 9.0E-09
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 118 335 1.0E-08
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 118 335 2.0E-08
sp|P11965|PERX_TOBAC Lignin-forming anionic peroxidase OS=Nicotiana tabacum PE=2 SV=1 118 252 2.0E-08
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 118 335 8.0E-08
sp|A2YPX3|PER2_ORYSI Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX112 PE=3 SV=2 118 348 9.0E-08
sp|Q0D3N0|PER2_ORYSJ Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PRX112 PE=2 SV=1 118 348 1.0E-07
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 118 337 3.0E-07
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 118 335 4.0E-07
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 118 337 5.0E-07
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 97 335 5.0E-07
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 55 348 8.0E-07
sp|A5H454|PER66_MAIZE Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1 118 331 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0006950 response to stress No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0050896 response to stimulus No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0843 0.0613 0.9679 0.1176 0.075 0.0134 0.1105 0.1314 0.0939 0.0017

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999178

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA2 2.3E-56 94 336

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup72
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7755
Ophiocordyceps australis map64 (Brazil) OphauB2|5788
Ophiocordyceps camponoti-floridani Ophcf2|03380
Ophiocordyceps camponoti-floridani Ophcf2|05952
Ophiocordyceps camponoti-floridani Ophcf2|06949
Ophiocordyceps camponoti-rufipedis Ophun1|2842
Ophiocordyceps camponoti-rufipedis Ophun1|490
Ophiocordyceps camponoti-rufipedis Ophun1|576
Ophiocordyceps kimflemingae Ophio5|1136
Ophiocordyceps kimflemingae Ophio5|3516
Ophiocordyceps kimflemingae Ophio5|4077
Ophiocordyceps kimflemingae Ophio5|6981 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2648
Ophiocordyceps subramaniannii Hirsu2|7177
Ophiocordyceps subramaniannii Hirsu2|7933
Ophiocordyceps subramaniannii Hirsu2|9306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6981
MKRTAAIVAALAGISSAYPAMEELMSHLSKRQTSTELIGDLATLQDGQLTQTGRDVKSILQGSASGLDATSTAGT
VPAKGSPECVQDTCCIWTYIALDMRNAMVDPDGQCNDVSRQSVRLGFHDAFGWSKSSGSAGGADGSIILAGECES
RTGNQGLSDICSRLRTWFNQYQQFGISMADLVQMAANVGTVSCPLGPRVRSFVGRKDSNQPSPRDDIPSSSGTAD
ELISQFAERTFTPNNLAALLGAHSTGRQTTVDPARAGAAFDSTPGVWDTEFYGQVLDPKAPSQVFKMQSDINLSQ
DPRTKQAWNAFVGTQGQGVWDGEYATAYVRMSLLGVENINDLTECTKVLPPFIASFNGTQPTA
Coding >Ophio5|6981
ATGAAGCGCACTGCGGCAATCGTTGCTGCCCTAGCCGGCATATCATCTGCTTATCCCGCCATGGAGGAGCTGATG
AGCCATCTCAGCAAACGACAGACATCGACGGAGCTAATAGGAGATCTGGCAACGCTTCAGGACGGCCAGCTGACC
CAGACAGGCCGTGATGTCAAATCGATTCTTCAAGGCTCGGCCTCTGGTCTCGATGCGACCTCTACCGCCGGCACT
GTACCGGCCAAGGGGTCTCCGGAGTGCGTTCAGGACACGTGCTGCATCTGGACGTACATCGCCCTGGACATGCGC
AACGCCATGGTCGACCCGGACGGGCAATGCAACGATGTATCCCGCCAGTCGGTTCGGCTGGGCTTCCACGATGCC
TTCGGCTGGTCCAAGTCTTCGGGTTCAGCCGGCGGTGCCGATGGCTCCATCATTCTAGCCGGAGAGTGCGAGAGC
AGGACGGGAAATCAAGGCTTGAGCGACATTTGCAGTCGGCTACGCACCTGGTTTAATCAGTATCAGCAATTCGGC
ATCTCTATGGCCGACTTGGTCCAGATGGCCGCCAACGTCGGCACCGTCTCTTGCCCTCTCGGACCACGCGTACGT
TCGTTCGTTGGACGCAAGGATTCCAACCAGCCTTCTCCGCGAGACGATATACCCTCGTCATCCGGCACGGCAGAC
GAGCTCATCAGCCAGTTTGCCGAAAGGACCTTCACCCCGAATAACCTTGCTGCTCTCCTGGGCGCGCATAGTACG
GGTCGCCAGACAACAGTTGACCCTGCACGGGCTGGCGCGGCGTTTGACAGCACCCCCGGCGTCTGGGACACGGAA
TTCTACGGCCAAGTTTTGGATCCCAAAGCTCCGAGCCAAGTGTTCAAGATGCAGAGTGATATAAATCTCAGCCAA
GACCCGCGGACGAAGCAAGCCTGGAACGCCTTTGTCGGCACACAAGGGCAAGGGGTCTGGGATGGGGAATATGCC
ACAGCATACGTCCGCATGAGCCTTCTCGGCGTTGAAAATATCAACGACTTGACCGAATGCACCAAGGTCCTACCC
CCTTTTATTGCGAGCTTCAACGGCACACAGCCGACTGCC
Transcript >Ophio5|6981
ATGAAGCGCACTGCGGCAATCGTTGCTGCCCTAGCCGGCATATCATCTGCTTATCCCGCCATGGAGGAGCTGATG
AGCCATCTCAGCAAACGACAGACATCGACGGAGCTAATAGGAGATCTGGCAACGCTTCAGGACGGCCAGCTGACC
CAGACAGGCCGTGATGTCAAATCGATTCTTCAAGGCTCGGCCTCTGGTCTCGATGCGACCTCTACCGCCGGCACT
GTACCGGCCAAGGGGTCTCCGGAGTGCGTTCAGGACACGTGCTGCATCTGGACGTACATCGCCCTGGACATGCGC
AACGCCATGGTCGACCCGGACGGGCAATGCAACGATGTATCCCGCCAGTCGGTTCGGCTGGGCTTCCACGATGCC
TTCGGCTGGTCCAAGTCTTCGGGTTCAGCCGGCGGTGCCGATGGCTCCATCATTCTAGCCGGAGAGTGCGAGAGC
AGGACGGGAAATCAAGGCTTGAGCGACATTTGCAGTCGGCTACGCACCTGGTTTAATCAGTATCAGCAATTCGGC
ATCTCTATGGCCGACTTGGTCCAGATGGCCGCCAACGTCGGCACCGTCTCTTGCCCTCTCGGACCACGCGTACGT
TCGTTCGTTGGACGCAAGGATTCCAACCAGCCTTCTCCGCGAGACGATATACCCTCGTCATCCGGCACGGCAGAC
GAGCTCATCAGCCAGTTTGCCGAAAGGACCTTCACCCCGAATAACCTTGCTGCTCTCCTGGGCGCGCATAGTACG
GGTCGCCAGACAACAGTTGACCCTGCACGGGCTGGCGCGGCGTTTGACAGCACCCCCGGCGTCTGGGACACGGAA
TTCTACGGCCAAGTTTTGGATCCCAAAGCTCCGAGCCAAGTGTTCAAGATGCAGAGTGATATAAATCTCAGCCAA
GACCCGCGGACGAAGCAAGCCTGGAACGCCTTTGTCGGCACACAAGGGCAAGGGGTCTGGGATGGGGAATATGCC
ACAGCATACGTCCGCATGAGCCTTCTCGGCGTTGAAAATATCAACGACTTGACCGAATGCACCAAGGTCCTACCC
CCTTTTATTGCGAGCTTCAACGGCACACAGCCGACTGCCTGA
Gene >Ophio5|6981
ATGAAGCGCACTGCGGCAATCGTTGCTGCCCTAGCCGGCATATCATCTGCTTATCCCGCCATGGAGGAGCTGATG
AGCCATCTCAGCAAACGACAGACATCGACGGAGCTAATAGGAGATCTGGCAACGCTTCAGGACGGCCAGCTGACC
CAGACAGGCCGTGATGTCAAATCGATTCTTCAAGGCTCGGCCTCTGGTCTCGATGCGACCTCTACCGCCGGCACT
GTACCGGCCAAGGGGTCTCCGGAGTGCGTTCAGGACACGTGCTGCATCTGGACGTACATCGCCCTGGACATGCGC
AACGCCATGGTCGACCCGGACGGGCAATGCAACGATGTATCCCGCCAGTCGGTTCGGCTGGGCTTCCACGATGCC
TTCGGCTGGTCCAAGTCTTCGGGTTCAGCCGGCGGTGCCGATGGCTCCATCATTCTAGCCGGAGAGTGCGAGAGC
AGGACGGGAAATCAAGGCTTGAGCGACATTTGCAGTCGGCTACGCACCTGGTTTAATCAGTATCAGCAATTCGGC
ATCTCTATGGCCGACTTGGTCCAGATGGCCGCCAACGTCGGCACCGTCTCTTGCCCTCTCGGACCACGCGTACGT
TCGTTCGTTGGACGCAAGGATTCCAACCAGCCTTCTCCGCGAGACGATATACCCTCGTCATCCGGCACGGCAGAC
GAGCTCATCAGCCAGTTTGCCGAAAGGACCTTCACCCCGAATAACCTTGCTGCTCTCCTGGGCGCGCATAGTACG
GGTCGCCAGACAACAGTTGACCCTGCACGGGCTGGCGCGGCGTTTGACAGCACCCCCGGCGTCTGGGACACGGAA
TTCTACGGCCAAGTTTTGGATCCCAAAGCTCCGAGCCAAGTGTTCAAGATGCAGAGTGATATAAATCTCAGCCAA
GACCCGCGGACGAAGCAAGCCTGGAACGCCTTTGTCGGCACACAAGGGCAAGGGGTCTGGGATGGGGTACGTTTC
AAGTTGTCATCGTTGATAATTCCTTTTTATCTAACCTTGTCTAGGAATATGCCACAGCATACGTCCGCATGAGCC
TTCTCGGCGTTGAAAATATCAACGACTTGACCGAATGCACCAAGGTCCTACCCCCTTTTATTGCGAGCTTCAACG
GCACACAGCCGACTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail