Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6979
Gene name
Locationscaffold_64:23090..24144
Strand+
Gene length (bp)1054
Transcript length (bp)798
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05875 Ceramidase Ceramidase 6.0E-69 10 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38298|YPC1_YEAST Alkaline ceramidase YPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPC1 PE=1 SV=1 10 224 6.0E-22
sp|Q9NUN7|ACER3_HUMAN Alkaline ceramidase 3 OS=Homo sapiens GN=ACER3 PE=1 SV=3 2 224 3.0E-21
sp|Q9D099|ACER3_MOUSE Alkaline ceramidase 3 OS=Mus musculus GN=Acer3 PE=2 SV=1 2 224 5.0E-19
sp|Q6TMJ1|DCD3A_DICDI Putative alkaline ceramidase dcd3A OS=Dictyostelium discoideum GN=dcd3A PE=2 SV=1 11 222 3.0E-14
sp|Q02896|YDC1_YEAST Alkaline ceramidase YDC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDC1 PE=1 SV=1 10 224 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38298|YPC1_YEAST Alkaline ceramidase YPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPC1 PE=1 SV=1 10 224 6.0E-22
sp|Q9NUN7|ACER3_HUMAN Alkaline ceramidase 3 OS=Homo sapiens GN=ACER3 PE=1 SV=3 2 224 3.0E-21
sp|Q9D099|ACER3_MOUSE Alkaline ceramidase 3 OS=Mus musculus GN=Acer3 PE=2 SV=1 2 224 5.0E-19
sp|Q6TMJ1|DCD3A_DICDI Putative alkaline ceramidase dcd3A OS=Dictyostelium discoideum GN=dcd3A PE=2 SV=1 11 222 3.0E-14
sp|Q02896|YDC1_YEAST Alkaline ceramidase YDC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDC1 PE=1 SV=1 10 224 3.0E-13
sp|Q55DQ0|DCD3B_DICDI Putative alkaline ceramidase dcd3B OS=Dictyostelium discoideum GN=dcd3B PE=3 SV=1 10 221 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Yes
GO:0006672 ceramide metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0006665 sphingolipid metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0016787 hydrolase activity No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 50 67 17
3 102 124 22
4 128 150 22
5 171 193 22
6 208 230 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6979
MANELSVVAQDYALTRYIAEFINTLSSLSYVAYGVYGLSSGSQKPQAGPRLASYCGLIGVGICSAGYHMTLKYHT
QMLDELSMHLLATPILYRLLTLGASPYYTKVVGVTLLVLFTIVMTTHILLDEFLLHATTFGLAVYLIATRIWHII
PQKVSDPLIRKKLQRMTSFGCANFLCGYFFWLVDEWACGLLTGLRHSLGFPMAFFLELHGWWHILTAIGGYMAVG
IVDVLTSGEVDKDPIDDFAWPVPQAMQFLSGTAKVKSHSE
Coding >Ophio5|6979
ATGGCTAATGAGCTGTCTGTCGTTGCACAGGATTATGCGCTTACGCGGTATATTGCCGAGTTCATCAACACTTTA
AGCAGCCTTTCCTATGTCGCTTATGGAGTCTATGGCCTGTCAAGCGGCTCACAAAAGCCTCAAGCCGGACCACGC
TTGGCCTCGTATTGTGGGCTGATAGGCGTGGGCATCTGCTCTGCTGGATATCACATGACGCTGAAATATCACACT
CAGATGTTGGATGAATTATCCATGCACCTTCTGGCCACCCCCATTCTTTACCGTCTACTTACCTTGGGAGCCAGC
CCTTACTACACCAAGGTGGTCGGTGTGACTCTCCTTGTACTCTTTACCATTGTCATGACCACCCACATCCTCTTG
GACGAGTTTCTCCTTCACGCAACAACATTCGGCCTTGCCGTATACTTGATCGCCACCCGAATATGGCACATCATC
CCGCAAAAAGTGTCTGATCCGCTCATCAGAAAGAAGCTGCAGAGGATGACGAGTTTCGGTTGCGCAAACTTTCTC
TGCGGCTACTTCTTCTGGCTGGTTGACGAATGGGCCTGCGGCCTCTTGACTGGCCTGAGGCATTCACTCGGTTTT
CCCATGGCCTTTTTCCTCGAACTCCATGGTTGGTGGCATATACTTACCGCCATTGGCGGCTACATGGCCGTTGGA
ATCGTCGACGTGTTAACATCAGGAGAGGTTGACAAGGACCCGATTGACGACTTTGCCTGGCCGGTTCCTCAGGCC
ATGCAGTTCCTGTCGGGCACAGCAAAAGTCAAGTCCCATAGTGAA
Transcript >Ophio5|6979
ATGGCTAATGAGCTGTCTGTCGTTGCACAGGATTATGCGCTTACGCGGTATATTGCCGAGTTCATCAACACTTTA
AGCAGCCTTTCCTATGTCGCTTATGGAGTCTATGGCCTGTCAAGCGGCTCACAAAAGCCTCAAGCCGGACCACGC
TTGGCCTCGTATTGTGGGCTGATAGGCGTGGGCATCTGCTCTGCTGGATATCACATGACGCTGAAATATCACACT
CAGATGTTGGATGAATTATCCATGCACCTTCTGGCCACCCCCATTCTTTACCGTCTACTTACCTTGGGAGCCAGC
CCTTACTACACCAAGGTGGTCGGTGTGACTCTCCTTGTACTCTTTACCATTGTCATGACCACCCACATCCTCTTG
GACGAGTTTCTCCTTCACGCAACAACATTCGGCCTTGCCGTATACTTGATCGCCACCCGAATATGGCACATCATC
CCGCAAAAAGTGTCTGATCCGCTCATCAGAAAGAAGCTGCAGAGGATGACGAGTTTCGGTTGCGCAAACTTTCTC
TGCGGCTACTTCTTCTGGCTGGTTGACGAATGGGCCTGCGGCCTCTTGACTGGCCTGAGGCATTCACTCGGTTTT
CCCATGGCCTTTTTCCTCGAACTCCATGGTTGGTGGCATATACTTACCGCCATTGGCGGCTACATGGCCGTTGGA
ATCGTCGACGTGTTAACATCAGGAGAGGTTGACAAGGACCCGATTGACGACTTTGCCTGGCCGGTTCCTCAGGCC
ATGCAGTTCCTGTCGGGCACAGCAAAAGTCAAGTCCCATAGTGAATAG
Gene >Ophio5|6979
ATGGCTAATGAGCTGTCTGTCGTTGCACAGGATTATGCGCTTACGCGGTATATTGCCGAGTTCATCAACACTTTA
AGCAGCCTTTCCTATGGTCGGTAATCCCGTGTTTGCACAGGGTTCAACGTCTAACCTAACGCCCGGTACCAGTCG
CTTATGGAGTCTATGGCCTGTCAAGCGGCTCACAAAAGCCTCAAGCCGGACCACGCTTGGCCTCGTATTGTGGGC
TGATAGGCGTGGGCATCTGCTCTGCTGGATATCACATGACGCTGAAATATCACACTCAGATGTGTAGGTCCACGG
CTCACTGATTTCCGACCACCTGTTGCTCTCCTGACTTATGCGATATGTAGTGGATGAATTATCCATGCACCTTCT
GGCCACCCCCATTCTTTACCGTCTACTTACCTTGGGAGCCAGCCCTTACTACACCAAGGTGGTCGGTGTGACTCT
CCTTGTACTCTTTACCATTGTCATGACCACCCACATCCTCTTGGACGAGTTTCTCCTTCACGCAACAACATTCGG
CCTTGCCGTATACTTGATCGCCACCCGAATATGGCACATCATCCCGCAAAAAGTGTCTGATCCGCTCATCAGAAA
GAAGCTGCAGAGGATGACGAGTTTCGGTTGCGGTGAGATTATTCCCTATTCCCGAATCCCCAACCACCCCTTTCC
TTCCTGACCTTATCTGACCCTTGGGGGAATTTCAGCAAACTTTCTCTGCGGCTACTTCTTCTGGCTGGTTGACGA
ATGGGCCTGCGGCCTCTTGACTGGCCTGAGGCATTCACTCGGTTTTCCCATGGCCTTTTTCCTCGAACTCCATGG
TTGGTACGGACGAACCTTTGTGGCTGCCATCTTACCGCTCTGCACTAACAGTCTCCTCCGTAGGTGGCATATACT
TACCGCCATTGGCGGCTACATGGCCGTTGGAATCGTCGACGTGTTAACATCAGGAGAGGTTGACAAGGACCCGAT
TGACGACTTTGCCTGGCCGGTTCCTCAGGCCATGCAGTTCCTGTCGGGCACAGCAAAAGTCAAGTCCCATAGTGA
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail