Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6978
Gene name
Locationscaffold_64:19374..21717
Strand+
Gene length (bp)2343
Transcript length (bp)2199
Coding sequence length (bp)2196
Protein length (aa) 732

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 1.2E-39 248 359
PF00394 Cu-oxidase Multicopper oxidase 2.2E-32 370 524
PF07731 Cu-oxidase_2 Multicopper oxidase 1.3E-14 657 729

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 217 729 7.0E-83
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 218 723 9.0E-68
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 217 731 3.0E-66
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 224 730 1.0E-64
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 265 730 3.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 217 729 7.0E-83
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 218 723 9.0E-68
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 217 731 3.0E-66
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 224 730 1.0E-64
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 265 730 3.0E-60
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 230 730 2.0E-59
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 220 730 3.0E-58
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 220 730 1.0E-52
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 238 529 2.0E-47
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 239 529 4.0E-46
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 236 730 2.0E-45
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 236 730 1.0E-44
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 238 515 8.0E-44
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 236 730 1.0E-43
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 237 507 1.0E-42
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 237 525 2.0E-42
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 231 507 1.0E-41
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 237 507 2.0E-40
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 240 504 3.0E-38
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 240 504 1.0E-37
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 237 730 1.0E-37
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 235 730 2.0E-37
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 240 730 3.0E-37
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 257 729 3.0E-37
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 236 729 3.0E-37
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 237 730 9.0E-37
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 234 729 1.0E-36
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 234 730 2.0E-36
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 240 504 8.0E-36
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 240 504 2.0E-35
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 240 504 6.0E-35
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 231 730 7.0E-35
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 242 504 9.0E-35
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 237 730 2.0E-34
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 231 730 2.0E-34
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 235 730 4.0E-34
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 255 502 4.0E-34
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 240 504 1.0E-33
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 257 725 3.0E-33
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 255 730 2.0E-32
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 255 530 2.0E-32
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 260 496 3.0E-32
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 262 504 3.0E-32
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 258 502 9.0E-32
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 240 504 1.0E-31
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 256 725 1.0E-31
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 256 502 3.0E-31
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 225 494 3.0E-31
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 240 504 6.0E-31
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 266 504 1.0E-30
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 235 502 1.0E-30
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 234 494 2.0E-30
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 258 502 2.0E-30
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 243 504 2.0E-30
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 239 730 4.0E-30
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 230 494 6.0E-30
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 256 502 8.0E-30
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 256 502 9.0E-30
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 243 504 1.0E-29
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 256 502 1.0E-29
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 256 502 2.0E-29
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 240 504 2.0E-29
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 256 502 7.0E-29
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 231 504 8.0E-29
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 256 502 9.0E-29
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 260 502 1.0E-28
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 256 502 1.0E-28
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 255 493 2.0E-28
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 236 504 4.0E-28
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 255 502 1.0E-27
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 261 504 1.0E-27
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 252 526 3.0E-27
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 237 498 2.0E-26
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 234 491 3.0E-26
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 237 502 5.0E-26
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 239 730 6.0E-26
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 255 502 9.0E-26
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 237 730 2.0E-25
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 237 493 2.0E-25
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 234 730 2.0E-25
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 238 524 7.0E-25
sp|Q9FHN6|SKS2_ARATH Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1 239 494 3.0E-21
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 238 495 5.0E-21
sp|P29162|ASOL_TOBAC L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1 239 526 2.0E-20
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 239 494 4.0E-20
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 255 691 1.0E-19
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 231 492 2.0E-19
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 239 494 2.0E-18
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 241 502 2.0E-18
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 255 535 3.0E-18
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 238 522 3.0E-17
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 252 495 7.0E-16
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 294 526 8.0E-15
sp|Q8Z9E1|CUEO_SALTI Blue copper oxidase CueO OS=Salmonella typhi GN=cueO PE=3 SV=1 261 491 2.0E-08
sp|P36649|CUEO_ECOLI Blue copper oxidase CueO OS=Escherichia coli (strain K12) GN=cueO PE=1 SV=2 229 494 3.0E-08
sp|Q8X947|CUEO_ECO57 Blue copper oxidase CueO OS=Escherichia coli O157:H7 GN=cueO PE=3 SV=1 229 494 4.0E-07
sp|B4F2J0|FTSP_PROMH Cell division protein FtsP OS=Proteus mirabilis (strain HI4320) GN=ftsP PE=3 SV=1 242 491 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 167 186 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.00 0.0 0.00
CcL In ants, during behavior modification 0.00 0.0 0.00
CcD In ants, recently dead 0.02 0.0 0.15

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6978
MKVSRTVLAALCLILPCQAAVSPALDKAPGPPAQAKAATPPVVHDKEAAAHHHQALSPPPAHEKAAVPPAHDKSP
SKAAAPISPNKQPVPAHGVSHADESWVGPGAPHGLSRYTSSESSIRGLSRLFLQLFLGPDAEHVVRSFAFPFAGF
HSGFVPQLSQAVTNGHVFFFFFFSSFTLLLLPLLLTRCDRRSMLGTPAQPYFPPYLLNNPLPNGFPWGRYNKYTN
YYRDYPKTGVIRRYEWTVSRGLLAADGYLKQVLQVNGQFPGPTIEANWGDTIEVIVHNDIRDPGEGVSFHWHGFL
QEGTPWEDGVPGVTECPIPPGASFTYVFDAQLYGTTWWHSHYSAQWAGGLFGAIIIYGPELVPYDFDAGPVLISD
YYHKDYFTLVEETLSPLTGGVFFSDNNLINGKMFFNCSLADEDNRPCNSNAGPAVFEFERGRTYRLRVINAGAEG
LQRFSIDGHKLLVIANDFVPVEPYETTVLTLGIGQRQDVIVKADGPLDAYWMRSTISEICSLTSQPQALAIINYV
DRHRTGVRNARSLDSDVQPGSISLANVNIPNSIPWNIPDPGTCANDPLAITVPVMRLPVIKPDLVWVFDIDTFVN
ASGVTLWRFGGVSERTDYNAPTLLLSNLGNYSFDPIWNVRAAVDLTNVRRVGGDLSALPPARSVRIVVNNLSPVD
HPMHLHGFNMQILNEGVGRWDGSIVRPQNPERRDVYMLQKNGYLAIQFNAIENPARC
Coding >Ophio5|6978
ATGAAGGTATCGCGTACTGTCTTGGCCGCTTTATGCCTGATTCTTCCTTGTCAGGCGGCCGTTTCCCCGGCCCTT
GACAAGGCGCCGGGTCCTCCAGCTCAGGCGAAGGCGGCTACGCCTCCGGTTGTTCACGATAAAGAAGCGGCCGCT
CATCACCACCAGGCGCTTTCTCCTCCACCGGCTCACGAAAAGGCGGCCGTCCCTCCGGCTCACGACAAATCGCCG
AGCAAAGCTGCTGCTCCCATCAGCCCAAACAAACAGCCGGTCCCTGCACACGGCGTGAGCCACGCCGACGAGTCA
TGGGTCGGTCCTGGAGCGCCACACGGTCTGTCGAGATACACTAGCTCGGAAAGCTCCATCCGCGGCCTTTCCAGA
CTCTTTCTACAACTCTTTCTCGGCCCGGACGCCGAACATGTCGTCCGATCCTTCGCCTTCCCCTTTGCCGGATTC
CACTCAGGCTTCGTGCCCCAGCTGAGCCAGGCTGTCACCAACGGGCACGTCTTTTTCTTCTTCTTCTTCTCTTCT
TTTACACTTCTCCTTCTCCCACTCTTGCTGACCAGATGTGACAGGCGATCGATGCTCGGCACACCCGCTCAGCCC
TATTTCCCGCCTTACCTTCTCAACAACCCTCTCCCCAACGGCTTCCCTTGGGGCAGATACAACAAATACACAAAC
TACTACAGGGACTATCCCAAAACTGGTGTTATCCGACGCTACGAATGGACCGTCAGTCGTGGCCTTTTAGCCGCC
GACGGCTACCTCAAGCAAGTCCTTCAGGTCAACGGCCAGTTCCCGGGGCCGACCATCGAGGCAAACTGGGGAGAC
ACCATCGAGGTCATAGTCCACAACGACATCAGAGACCCGGGAGAGGGCGTCTCTTTCCACTGGCATGGCTTCCTT
CAGGAGGGTACGCCGTGGGAAGACGGCGTGCCTGGCGTCACCGAGTGCCCGATCCCCCCCGGAGCCTCCTTCACG
TACGTCTTTGACGCCCAGCTGTACGGCACCACCTGGTGGCACAGCCACTATTCGGCGCAATGGGCCGGAGGCCTC
TTCGGCGCCATCATCATCTATGGACCTGAACTGGTGCCGTACGATTTCGACGCCGGCCCGGTCCTCATCTCGGAT
TATTACCACAAGGATTACTTCACCCTGGTTGAGGAGACCTTGTCGCCACTCACCGGCGGCGTCTTCTTTTCCGAT
AACAACCTCATCAACGGCAAGATGTTCTTCAACTGCTCCCTCGCCGACGAGGACAATCGGCCTTGCAATAGTAAT
GCCGGGCCGGCCGTTTTCGAATTCGAGCGTGGCAGGACCTACCGCTTGAGGGTGATCAATGCCGGAGCCGAGGGC
TTGCAGCGCTTCTCGATAGATGGCCACAAACTGCTCGTCATCGCCAACGACTTTGTTCCCGTCGAGCCCTACGAG
ACGACTGTGCTGACGCTGGGCATTGGCCAACGCCAGGATGTCATTGTCAAGGCAGACGGGCCCCTGGACGCCTAC
TGGATGCGAAGCACCATATCGGAAATATGCAGTCTGACGTCTCAGCCGCAAGCTCTGGCCATCATCAACTACGTC
GACAGGCACAGGACCGGCGTCAGGAACGCCCGATCGCTCGATTCGGACGTTCAACCGGGCTCCATCAGTCTGGCC
AACGTCAATATACCCAATTCCATACCTTGGAACATCCCGGACCCCGGAACCTGCGCCAACGACCCTCTTGCCATA
ACGGTTCCCGTCATGAGACTGCCGGTCATCAAGCCTGATCTGGTTTGGGTCTTTGACATTGATACTTTTGTCAAC
GCCAGTGGTGTGACGCTTTGGCGCTTCGGCGGCGTCTCGGAAAGGACCGACTATAACGCTCCGACGCTTCTTCTG
AGCAACCTGGGCAACTACTCCTTTGACCCCATCTGGAATGTGAGGGCCGCCGTAGACCTAACCAACGTCCGAAGA
GTTGGAGGAGACTTGAGCGCTCTCCCACCGGCGAGAAGCGTGAGGATCGTGGTGAACAACCTGTCTCCCGTGGAT
CACCCTATGCATCTTCACGGGTTCAACATGCAGATCTTGAACGAAGGCGTCGGAAGATGGGACGGCTCCATCGTT
CGGCCGCAGAATCCCGAACGACGAGATGTCTACATGTTGCAGAAAAACGGCTACCTAGCTATCCAGTTTAACGCC
ATTGAGAATCCAGCGAGATGC
Transcript >Ophio5|6978
ATGAAGGTATCGCGTACTGTCTTGGCCGCTTTATGCCTGATTCTTCCTTGTCAGGCGGCCGTTTCCCCGGCCCTT
GACAAGGCGCCGGGTCCTCCAGCTCAGGCGAAGGCGGCTACGCCTCCGGTTGTTCACGATAAAGAAGCGGCCGCT
CATCACCACCAGGCGCTTTCTCCTCCACCGGCTCACGAAAAGGCGGCCGTCCCTCCGGCTCACGACAAATCGCCG
AGCAAAGCTGCTGCTCCCATCAGCCCAAACAAACAGCCGGTCCCTGCACACGGCGTGAGCCACGCCGACGAGTCA
TGGGTCGGTCCTGGAGCGCCACACGGTCTGTCGAGATACACTAGCTCGGAAAGCTCCATCCGCGGCCTTTCCAGA
CTCTTTCTACAACTCTTTCTCGGCCCGGACGCCGAACATGTCGTCCGATCCTTCGCCTTCCCCTTTGCCGGATTC
CACTCAGGCTTCGTGCCCCAGCTGAGCCAGGCTGTCACCAACGGGCACGTCTTTTTCTTCTTCTTCTTCTCTTCT
TTTACACTTCTCCTTCTCCCACTCTTGCTGACCAGATGTGACAGGCGATCGATGCTCGGCACACCCGCTCAGCCC
TATTTCCCGCCTTACCTTCTCAACAACCCTCTCCCCAACGGCTTCCCTTGGGGCAGATACAACAAATACACAAAC
TACTACAGGGACTATCCCAAAACTGGTGTTATCCGACGCTACGAATGGACCGTCAGTCGTGGCCTTTTAGCCGCC
GACGGCTACCTCAAGCAAGTCCTTCAGGTCAACGGCCAGTTCCCGGGGCCGACCATCGAGGCAAACTGGGGAGAC
ACCATCGAGGTCATAGTCCACAACGACATCAGAGACCCGGGAGAGGGCGTCTCTTTCCACTGGCATGGCTTCCTT
CAGGAGGGTACGCCGTGGGAAGACGGCGTGCCTGGCGTCACCGAGTGCCCGATCCCCCCCGGAGCCTCCTTCACG
TACGTCTTTGACGCCCAGCTGTACGGCACCACCTGGTGGCACAGCCACTATTCGGCGCAATGGGCCGGAGGCCTC
TTCGGCGCCATCATCATCTATGGACCTGAACTGGTGCCGTACGATTTCGACGCCGGCCCGGTCCTCATCTCGGAT
TATTACCACAAGGATTACTTCACCCTGGTTGAGGAGACCTTGTCGCCACTCACCGGCGGCGTCTTCTTTTCCGAT
AACAACCTCATCAACGGCAAGATGTTCTTCAACTGCTCCCTCGCCGACGAGGACAATCGGCCTTGCAATAGTAAT
GCCGGGCCGGCCGTTTTCGAATTCGAGCGTGGCAGGACCTACCGCTTGAGGGTGATCAATGCCGGAGCCGAGGGC
TTGCAGCGCTTCTCGATAGATGGCCACAAACTGCTCGTCATCGCCAACGACTTTGTTCCCGTCGAGCCCTACGAG
ACGACTGTGCTGACGCTGGGCATTGGCCAACGCCAGGATGTCATTGTCAAGGCAGACGGGCCCCTGGACGCCTAC
TGGATGCGAAGCACCATATCGGAAATATGCAGTCTGACGTCTCAGCCGCAAGCTCTGGCCATCATCAACTACGTC
GACAGGCACAGGACCGGCGTCAGGAACGCCCGATCGCTCGATTCGGACGTTCAACCGGGCTCCATCAGTCTGGCC
AACGTCAATATACCCAATTCCATACCTTGGAACATCCCGGACCCCGGAACCTGCGCCAACGACCCTCTTGCCATA
ACGGTTCCCGTCATGAGACTGCCGGTCATCAAGCCTGATCTGGTTTGGGTCTTTGACATTGATACTTTTGTCAAC
GCCAGTGGTGTGACGCTTTGGCGCTTCGGCGGCGTCTCGGAAAGGACCGACTATAACGCTCCGACGCTTCTTCTG
AGCAACCTGGGCAACTACTCCTTTGACCCCATCTGGAATGTGAGGGCCGCCGTAGACCTAACCAACGTCCGAAGA
GTTGGAGGAGACTTGAGCGCTCTCCCACCGGCGAGAAGCGTGAGGATCGTGGTGAACAACCTGTCTCCCGTGGAT
CACCCTATGCATCTTCACGGGTTCAACATGCAGATCTTGAACGAAGGCGTCGGAAGATGGGACGGCTCCATCGTT
CGGCCGCAGAATCCCGAACGACGAGATGTCTACATGTTGCAGAAAAACGGCTACCTAGCTATCCAGTTTAACGCC
ATTGAGAATCCAGCGAGATGCTAA
Gene >Ophio5|6978
ATGAAGGTATCGCGTACTGTCTTGGCCGCTTTATGCCTGATTCTTCCTTGTCAGGCGGCCGTTTCCCCGGCCCTT
GACAAGGCGCCGGGTCCTCCAGCTCAGGCGAAGGCGGCTACGCCTCCGGTTGTTCACGATAAAGAAGCGGCCGCT
CATCACCACCAGGCGCTTTCTCCTCCACCGGCTCACGAAAAGGCGGCCGTCCCTCCGGCTCACGACAAATCGCCG
AGCAAAGCTGCTGCTCCCATCAGCCCAAACAAACAGCCGGTCCCTGCACACGGCGTGAGCCACGCCGACGAGTCA
TGGGTCGGTCCTGGAGCGCCACACGGTCTGTCGAGATACACTAGCTCGGAAAGCTCCATCCGCGGCCTTTCCAGA
CTCTTTCTACAACTCTTTCTCGGCCCGGACGCCGAACATGTCGTCCGATCCTTCGCCTTCCCCTTTGCCGGATTC
CACTCAGGCTTCGTGCCCCAGCTGAGCCAGGCTGTCACCAACGGGCACGTCTTTTTCTTCTTCTTCTTCTCTTCT
TTTACACTTCTCCTTCTCCCACTCTTGCTGACCAGATGTGACAGGCGATCGATGCTCGGCACACCCGCTCAGCCC
TATTTCCCGCCTTACCTTCTCAACAACCCTCTCCCCAACGGCTTCCCTTGGGGCAGATACAACAAATACACAAAC
TACTACAGGGACTATCCCAAAACTGGTGTTATCCGACGCTACGAATGGACCGTCAGTCGTGGCCTTTTAGCCGCC
GACGGCTACCTCAAGCAAGTCCTTCAGGTCAACGGCCAGTTCCCGGGGCCGACCATCGAGGCAAACTGGGGAGAC
ACCATCGAGGTCATAGTCCACAACGACATCAGAGACCCGGGAGAGGGCGTCTCTTTCCACTGGCATGGCTTCCTT
CAGGAGGGTACGCCGTGGGAAGACGGCGTGCCTGGCGTCACCGAGTGCCCGATCCCCCCCGGAGCCTCCTTCACG
TACGTCTTTGACGCCCAGCTGTACGGCACCACCTGGTGGCACAGCCACTATTCGGCGCAATGGGCCGGAGGCCTC
TTCGGCGCCATCATCATCTATGGACCTGAACTGGTGCCGTACGATTTCGACGCCGGCCCGGTCCTCATCTCGGAT
TATTACCACAAGGATTACTTCACCCTGGTTGAGGAGACCTTGTCGCCACTCACCGGCGGCGTCTTCTTTTCCGAT
AACAACCTCATCAACGGCAAGATGTTCTTCAACTGCTCCCTCGCCGACGAGGACAATCGGCCTTGCAATAGTAAT
GCCGGGCCGGCCGTTTTCGAATTCGAGCGTGGCAGGACCTACCGCTTGAGGGTGATCAATGCCGGAGCCGAGGGC
TTGCAGCGCTTCTCGATAGATGGCCACAAACTGCTCGTCATCGCCAACGACTTTGTTCCCGTCGAGCCCTACGAG
ACGACTGTGCTGACGCTGGGCATTGGCCAACGCCAGGATGTCATTGTCAAGGCAGACGGGCCCCTGGACGCCTAC
TGGATGCGAAGCACCATATCGGAAATATGCAGTCTGACGTCTCAGCCGCAAGCTCTGGCCATCATCAACTACGTC
GACAGGCACAGGACCGGCGTCAGGAACGCCCGATCGCTCGATTCGGACGTTCAACCGGGCTCCATCAGTCTGGCC
AACGTCAATATACCCAATTCCATACCTTGGAACATCCCGGACCCCGGAACCTGCGCCAACGACCCTCTTGCCATA
ACGGTTCCCGTCATGAGACTGCCGGTCATCAAGCCTGATCTGGTTTGGGTCTTTGACATTGATACTTTTGTCAAC
GCCAGTGGTGTGACGCTTTGGCGCTTCGGCGGCGTCTCGGAAAGGACCGACTATAACGCTCCGACGCTTCTTCTG
AGCAACCTGGGCAACTACTCCTTTGACCCCATCTGGAATGTGAGGGCCGCCGTAGACCTAACCAACGTCCGAAGA
GTTGGAGGAGACTTGAGCGCTCTCCCACCGGCGAGAAGCGTGAGGATCGTGGTGAACAACCTGTCTCCCGTGGAG
TACGTGATTTTTTCTTCTTCTTTTTTTTCCCCCATTCTTTCATTCATGGGGGTGAGGTTATACTGACGACGGGCT
CTCCTTTTCCCAGTCACCCTATGCATCTTCACGGGTTCAACATGCAGATCTTGAACGAAGGCGTCGGAAGATGGG
ACGGCTCCATCGTTCGGCCGCAGAATCCCGAACGACGAGATGTCTACATGTTGCAGAAAAACGGCTACCTAGCTA
TCCAGTTTAACGCCATTGAGAATCCAGGTAAGTTTGACAACAACAAGGGGAGAGAGGTTTATTTTGTTTTGTTTA
ATGCGAGCGAGATGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail