Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6975
Gene name
Locationscaffold_64:13644..15273
Strand+
Gene length (bp)1629
Transcript length (bp)1392
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 1.9E-56 182 440
PF05195 AMP_N Aminopeptidase P, N-terminal domain 8.2E-23 20 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9EK74|AMPP3_METRA Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|E9DV56|AMPP3_METAQ Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium acridum (strain CQMa 102) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|C7Z837|AMPP2_NECH7 Probable Xaa-Pro aminopeptidase NECHADRAFT_60613 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_60613 PE=3 SV=1 3 462 0.0E+00
sp|A7UWH7|AMPP2_NEUCR Probable Xaa-Pro aminopeptidase NCU11288 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11288 PE=3 SV=1 3 463 0.0E+00
sp|D1ZQL9|AMPP2_SORMK Probable Xaa-Pro aminopeptidase SMAC_04549 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_04549 PE=3 SV=1 3 463 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9EK74|AMPP3_METRA Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|E9DV56|AMPP3_METAQ Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium acridum (strain CQMa 102) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|C7Z837|AMPP2_NECH7 Probable Xaa-Pro aminopeptidase NECHADRAFT_60613 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_60613 PE=3 SV=1 3 462 0.0E+00
sp|A7UWH7|AMPP2_NEUCR Probable Xaa-Pro aminopeptidase NCU11288 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11288 PE=3 SV=1 3 463 0.0E+00
sp|D1ZQL9|AMPP2_SORMK Probable Xaa-Pro aminopeptidase SMAC_04549 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_04549 PE=3 SV=1 3 463 0.0E+00
sp|E3QYP0|AMPP3_COLGM Probable Xaa-Pro aminopeptidase PEPP OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=PEPP PE=3 SV=1 3 461 0.0E+00
sp|B2AFW1|AMPP3_PODAN Probable Xaa-Pro aminopeptidase PEPP OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PEPP PE=3 SV=1 3 463 0.0E+00
sp|C9SDK8|AMPP2_VERA1 Probable Xaa-Pro aminopeptidase VDBG_02538 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_02538 PE=3 SV=1 1 460 0.0E+00
sp|A4RAE9|AMPP3_MAGO7 Probable Xaa-Pro aminopeptidase PEPP OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PEPP PE=3 SV=1 3 463 0.0E+00
sp|A6SDE9|AMPP3_BOTFB Probable Xaa-Pro aminopeptidase pepP OS=Botryotinia fuckeliana (strain B05.10) GN=pepP PE=3 SV=1 5 463 0.0E+00
sp|A7EUB3|AMPP3_SCLS1 Probable Xaa-Pro aminopeptidase pepP OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pepP PE=3 SV=1 8 461 0.0E+00
sp|C7YVN8|AMPP3_NECH7 Probable Xaa-Pro aminopeptidase PEPP OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PEPP PE=3 SV=1 3 460 0.0E+00
sp|B8M0Z4|AMPP3_TALSN Probable Xaa-Pro aminopeptidase pepP OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|B6Q8T5|AMPP3_TALMQ Probable Xaa-Pro aminopeptidase pepP OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|Q96WX8|AMPP3_EMENI Probable Xaa-Pro aminopeptidase pepP OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pepP PE=3 SV=2 1 461 0.0E+00
sp|A2QKF6|AMPP3_ASPNC Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|Q0U6G5|AMPP3_PHANO Probable Xaa-Pro aminopeptidase PEPP OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEPP PE=3 SV=1 3 463 0.0E+00
sp|C5PHM7|AMPP3_COCP7 Probable Xaa-Pro aminopeptidase PEPP OS=Coccidioides posadasii (strain C735) GN=PEPP PE=3 SV=1 8 463 0.0E+00
sp|A1CSI0|AMPP3_ASPCL Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|B6H2M0|AMPP3_PENRW Probable Xaa-Pro aminopeptidase pepP OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|E9DDK8|AMPP3_COCPS Probable Xaa-Pro aminopeptidase PEPP OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=PEPP PE=3 SV=1 8 463 0.0E+00
sp|Q4X267|AMPP3_ASPFU Probable Xaa-Pro aminopeptidase pepP OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|B0XW47|AMPP3_ASPFC Probable Xaa-Pro aminopeptidase pepP OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|A1DG66|AMPP3_NEOFI Probable Xaa-Pro aminopeptidase pepP OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|B8NC10|AMPP3_ASPFN Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|B2WMQ2|AMPP3_PYRTR Probable Xaa-Pro aminopeptidase pepP OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pepP PE=3 SV=1 3 460 0.0E+00
sp|C0NIF0|AMPP3_AJECG Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|C6H7R7|AMPP3_AJECH Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces capsulatus (strain H143) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|Q0CFZ0|AMPP3_ASPTN Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|C5JQ04|AMPP3_AJEDS Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces dermatitidis (strain SLH14081) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|C5G874|AMPP3_AJEDR Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|E3S6N7|AMPP3_PYRTT Probable Xaa-Pro aminopeptidase pepP OS=Pyrenophora teres f. teres (strain 0-1) GN=pepP PE=3 SV=1 3 460 0.0E+00
sp|D5GHP2|AMPP2_TUBMM Probable Xaa-Pro aminopeptidase GSTUM_00008071001 OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00008071001 PE=3 SV=1 8 452 0.0E+00
sp|C1H9Q9|AMPP3_PARBA Probable Xaa-Pro aminopeptidase PEPP OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PEPP PE=3 SV=1 5 462 0.0E+00
sp|C1GD57|AMPP3_PARBD Probable Xaa-Pro aminopeptidase PEPP OS=Paracoccidioides brasiliensis (strain Pb18) GN=PEPP PE=3 SV=1 11 462 1.0E-180
sp|C0SHQ0|AMPP3_PARBP Probable Xaa-Pro aminopeptidase PEPP OS=Paracoccidioides brasiliensis (strain Pb03) GN=PEPP PE=3 SV=1 11 462 4.0E-180
sp|C4JF09|AMPP3_UNCRE Probable Xaa-Pro aminopeptidase PEPP OS=Uncinocarpus reesii (strain UAMH 1704) GN=PEPP PE=3 SV=1 8 463 6.0E-180
sp|E4ZHV7|AMPP3_LEPMJ Probable Xaa-Pro aminopeptidase PEPP OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEPP PE=3 SV=1 3 463 1.0E-179
sp|E3Q897|AMPP2_COLGM Probable Xaa-Pro aminopeptidase GLRG_02280 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_02280 PE=3 SV=1 8 448 1.0E-119
sp|P43590|YFH6_YEAST Uncharacterized peptidase YFR006W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFR006W PE=1 SV=1 11 463 7.0E-116
sp|B2WKR4|AMPP2_PYRTR Probable Xaa-Pro aminopeptidase PTRG_10574 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_10574 PE=3 SV=1 2 451 5.0E-111
sp|E9F9J8|AMPP2_METRA Probable Xaa-Pro aminopeptidase MAA_08947 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_08947 PE=3 SV=2 5 451 9.0E-110
sp|A6SL16|AMPP2_BOTFB Probable Xaa-Pro aminopeptidase BC1G_13431 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_13431 PE=3 SV=1 3 451 1.0E-109
sp|E3RNJ5|AMPP2_PYRTT Probable Xaa-Pro aminopeptidase PTT_10145 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_10145 PE=3 SV=1 11 451 4.0E-109
sp|A4RQ11|AMPP2_MAGO7 Probable Xaa-Pro aminopeptidase MGG_05684 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05684 PE=3 SV=1 11 451 2.0E-108
sp|C5GKT2|AMPP2_AJEDR Probable Xaa-Pro aminopeptidase BDCG_04966 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_04966 PE=3 SV=1 11 463 2.0E-108
sp|C5K0R2|AMPP2_AJEDS Probable Xaa-Pro aminopeptidase BDBG_08406 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_08406 PE=3 SV=1 11 463 4.0E-108
sp|E9E2J4|AMPP2_METAQ Probable Xaa-Pro aminopeptidase MAC_04092 OS=Metarhizium acridum (strain CQMa 102) GN=MAC_04092 PE=3 SV=1 3 451 1.0E-107
sp|A7ENP9|AMPP2_SCLS1 Probable Xaa-Pro aminopeptidase SS1G_06948 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_06948 PE=3 SV=1 3 451 2.0E-107
sp|B8M2W9|AMPP2_TALSN Probable Xaa-Pro aminopeptidase TSTA_094700 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_094700 PE=3 SV=1 11 451 6.0E-104
sp|C0NF18|AMPP2_AJECG Probable Xaa-Pro aminopeptidase HCBG_01484 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_01484 PE=3 SV=1 11 463 2.0E-103
sp|A6QYF6|AMPP2_AJECN Probable Xaa-Pro aminopeptidase HCAG_02413 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_02413 PE=3 SV=1 11 463 1.0E-102
sp|C1H3X3|AMPP2_PARBA Probable Xaa-Pro aminopeptidase PAAG_05466 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_05466 PE=3 SV=2 11 451 2.0E-102
sp|C6HNY5|AMPP2_AJECH Probable Xaa-Pro aminopeptidase HCDG_07916 OS=Ajellomyces capsulatus (strain H143) GN=HCDG_07916 PE=3 SV=1 11 463 5.0E-102
sp|Q0CZM6|AMPP2_ASPTN Probable Xaa-Pro aminopeptidase ATEG_00858 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_00858 PE=3 SV=1 11 451 9.0E-102
sp|E9CY14|AMPP2_COCPS Probable Xaa-Pro aminopeptidase CPSG_02684 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02684 PE=3 SV=1 11 451 9.0E-102
sp|C5PAH2|AMPP2_COCP7 Probable Xaa-Pro aminopeptidase CPC735_009100 OS=Coccidioides posadasii (strain C735) GN=CPC735_009100 PE=3 SV=1 11 451 1.0E-101
sp|A1D1S6|AMPP2_NEOFI Probable Xaa-Pro aminopeptidase NFIA_010500 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_010500 PE=3 SV=1 11 451 6.0E-101
sp|A1CNW6|AMPP2_ASPCL Probable Xaa-Pro aminopeptidase ACLA_020440 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_020440 PE=3 SV=1 11 459 6.0E-101
sp|D1ZBF6|AMPP3_SORMK Probable Xaa-Pro aminopeptidase PEPP OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PEPP PE=3 SV=1 3 451 9.0E-101
sp|D4D6B8|AMPP2_TRIVH Probable Xaa-Pro aminopeptidase TRV_02643 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02643 PE=3 SV=1 4 451 2.0E-100
sp|D4B0B2|AMPP2_ARTBC Probable Xaa-Pro aminopeptidase ARB_01886 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01886 PE=3 SV=1 4 451 2.0E-99
sp|A2QAW7|AMPP2_ASPNC Probable Xaa-Pro aminopeptidase An01g13040 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g13040 PE=3 SV=1 11 451 4.0E-99
sp|C0SDW6|AMPP2_PARBP Probable Xaa-Pro aminopeptidase PABG_05921 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_05921 PE=3 SV=1 11 451 8.0E-99
sp|C1GHS9|AMPP2_PARBD Probable Xaa-Pro aminopeptidase PADG_06815 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_06815 PE=3 SV=2 11 451 8.0E-99
sp|Q5BF48|AMPP2_EMENI Probable Xaa-Pro aminopeptidase AN0832 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0832 PE=3 SV=1 11 459 3.0E-97
sp|E4V1Q7|AMPP2_ARTGP Probable Xaa-Pro aminopeptidase MGYG_06974 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_06974 PE=3 SV=1 11 451 3.0E-97
sp|B6HAN0|AMPP2_PENRW Probable Xaa-Pro aminopeptidase Pc16g13390 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc16g13390 PE=3 SV=1 15 451 8.0E-97
sp|Q2UQH9|AMPP2_ASPOR Probable Xaa-Pro aminopeptidase AO090005001240 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005001240 PE=3 SV=1 11 451 2.0E-94
sp|Q4WRV9|AMPP2_ASPFU Probable Xaa-Pro aminopeptidase AFUA_1G14920 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G14920 PE=3 SV=1 11 451 5.0E-94
sp|B0XN37|AMPP2_ASPFC Probable Xaa-Pro aminopeptidase AFUB_014460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_014460 PE=3 SV=1 11 451 5.0E-94
sp|Q0V147|AMPP2_PHANO Probable Xaa-Pro aminopeptidase SNOG_02267 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02267 PE=3 SV=2 5 451 3.0E-92
sp|B8MZI5|AMPP2_ASPFN Probable Xaa-Pro aminopeptidase AFLA_084750 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_084750 PE=3 SV=1 14 451 2.0E-91
sp|B2AW39|AMPP2_PODAN Probable Xaa-Pro aminopeptidase PODANS_7_5850 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_7_5850 PE=3 SV=1 9 364 3.0E-90
sp|C5FUV0|AMPP2_ARTOC Probable Xaa-Pro aminopeptidase MCYG_06503 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_06503 PE=3 SV=1 11 451 2.0E-85
sp|C4JY72|AMPP2_UNCRE Probable Xaa-Pro aminopeptidase UREG_07123 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07123 PE=3 SV=1 64 451 4.0E-84
sp|Q2HA12|AMPP2_CHAGB Probable Xaa-Pro aminopeptidase CHGG_02942 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_02942 PE=3 SV=1 11 365 2.0E-81
sp|C9SEV5|AMPP3_VERA1 Probable Xaa-Pro aminopeptidase PEPP OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=PEPP PE=3 SV=1 11 451 4.0E-76
sp|B6QAW7|AMPP2_TALMQ Probable Xaa-Pro aminopeptidase PMAA_074180 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_074180 PE=3 SV=1 99 451 3.0E-75
sp|P12955|PEPD_HUMAN Xaa-Pro dipeptidase OS=Homo sapiens GN=PEPD PE=1 SV=3 19 461 2.0E-67
sp|Q11136|PEPD_MOUSE Xaa-Pro dipeptidase OS=Mus musculus GN=Pepd PE=1 SV=3 19 461 5.0E-66
sp|Q5RFB3|PEPD_PONAB Xaa-Pro dipeptidase OS=Pongo abelii GN=PEPD PE=2 SV=1 19 461 6.0E-66
sp|Q5I0D7|PEPD_RAT Xaa-Pro dipeptidase OS=Rattus norvegicus GN=Pepd PE=2 SV=1 19 461 7.0E-66
sp|Q55E60|PEPD_DICDI Xaa-Pro dipeptidase OS=Dictyostelium discoideum GN=pepd PE=1 SV=1 20 460 1.0E-65
sp|P44881|AMPP_HAEIN Xaa-Pro aminopeptidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pepP PE=3 SV=1 4 461 2.0E-59
sp|P15034|AMPP_ECOLI Xaa-Pro aminopeptidase OS=Escherichia coli (strain K12) GN=pepP PE=1 SV=2 19 460 1.0E-55
sp|A1TXT7|PEPQ_MARHV Xaa-Pro dipeptidase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pepQ PE=3 SV=1 172 447 2.0E-42
sp|A0KR51|PEPQ_SHESA Xaa-Pro dipeptidase OS=Shewanella sp. (strain ANA-3) GN=pepQ PE=3 SV=1 19 447 1.0E-41
sp|Q0I0T2|PEPQ_SHESR Xaa-Pro dipeptidase OS=Shewanella sp. (strain MR-7) GN=pepQ PE=3 SV=1 19 447 2.0E-41
sp|Q0HPB6|PEPQ_SHESM Xaa-Pro dipeptidase OS=Shewanella sp. (strain MR-4) GN=pepQ PE=3 SV=1 19 447 2.0E-40
sp|A6WHA1|PEPQ_SHEB8 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS185) GN=pepQ PE=3 SV=1 19 447 2.0E-40
sp|Q8EKR8|PEPQ_SHEON Xaa-Pro dipeptidase OS=Shewanella oneidensis (strain MR-1) GN=pepQ PE=3 SV=1 19 447 2.0E-40
sp|Q9NQH7|XPP3_HUMAN Probable Xaa-Pro aminopeptidase 3 OS=Homo sapiens GN=XPNPEP3 PE=1 SV=1 49 463 2.0E-40
sp|A1RDW7|PEPQ_SHESW Xaa-Pro dipeptidase OS=Shewanella sp. (strain W3-18-1) GN=pepQ PE=3 SV=1 19 447 4.0E-40
sp|A4Y1B7|PEPQ_SHEPC Xaa-Pro dipeptidase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pepQ PE=3 SV=1 19 447 4.0E-40
sp|A9KU92|PEPQ_SHEB9 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS195) GN=pepQ PE=3 SV=1 19 447 5.0E-40
sp|B8E3R4|PEPQ_SHEB2 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS223) GN=pepQ PE=3 SV=1 19 447 7.0E-40
sp|A3CYJ5|PEPQ_SHEB5 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pepQ PE=3 SV=1 19 450 1.0E-39
sp|B7ZMP1|XPP3_MOUSE Probable Xaa-Pro aminopeptidase 3 OS=Mus musculus GN=Xpnpep3 PE=1 SV=1 49 462 2.0E-39
sp|Q5R9W8|XPP3_PONAB Probable Xaa-Pro aminopeptidase 3 OS=Pongo abelii GN=XPNPEP3 PE=2 SV=1 49 463 2.0E-39
sp|Q54T46|XPP3_DICDI Probable Xaa-Pro aminopeptidase 3 OS=Dictyostelium discoideum GN=xpnpep3 PE=2 SV=1 50 462 5.0E-39
sp|P0A3Z2|AMPP1_STRLI Xaa-Pro aminopeptidase 1 OS=Streptomyces lividans GN=pepPI PE=1 SV=2 49 461 7.0E-39
sp|P0A3Z1|AMPP1_STRCO Xaa-Pro aminopeptidase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pepPI PE=3 SV=2 49 461 7.0E-39
sp|A3Q8U5|PEPQ_SHELP Xaa-Pro dipeptidase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pepQ PE=3 SV=1 19 447 1.0E-38
sp|B5DEQ3|XPP3_RAT Probable Xaa-Pro aminopeptidase 3 OS=Rattus norvegicus GN=Xpnpep3 PE=1 SV=1 48 462 2.0E-37
sp|B8CHA2|PEPQ_SHEPW Xaa-Pro dipeptidase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=pepQ PE=3 SV=1 31 447 1.0E-36
sp|A8GYG1|PEPQ_SHEPA Xaa-Pro dipeptidase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pepQ PE=3 SV=1 141 447 3.0E-36
sp|Q48AT5|PEPQ_COLP3 Xaa-Pro dipeptidase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pepQ PE=3 SV=1 1 447 4.0E-36
sp|Q3IJ21|PEPQ_PSEHT Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pepQ PE=3 SV=1 32 447 1.0E-35
sp|A8FP64|PEPQ_SHESH Xaa-Pro dipeptidase OS=Shewanella sediminis (strain HAW-EB3) GN=pepQ PE=3 SV=1 19 447 1.0E-35
sp|A4STF0|PEPQ_AERS4 Xaa-Pro dipeptidase OS=Aeromonas salmonicida (strain A449) GN=pepQ PE=3 SV=1 49 447 3.0E-35
sp|Q15ZF7|PEPQ_PSEA6 Xaa-Pro dipeptidase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pepQ PE=3 SV=1 32 447 4.0E-35
sp|Q10439|ICP55_SCHPO Intermediate cleaving peptidase 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=icp55 PE=3 SV=2 55 459 5.0E-35
sp|P40051|ICP55_YEAST Intermediate cleaving peptidase 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICP55 PE=1 SV=1 54 463 8.0E-35
sp|B0TLC0|PEPQ_SHEHH Xaa-Pro dipeptidase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pepQ PE=3 SV=1 19 447 8.0E-35
sp|B1KCZ4|PEPQ_SHEWM Xaa-Pro dipeptidase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pepQ PE=3 SV=1 20 447 8.0E-35
sp|P77814|PEPQ_PSEHA Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplanktis GN=pepQ PE=1 SV=1 32 447 1.0E-34
sp|Q08A38|PEPQ_SHEFN Xaa-Pro dipeptidase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pepQ PE=3 SV=1 19 447 1.0E-34
sp|B2FT23|PEPQ_STRMK Xaa-Pro dipeptidase OS=Stenotrophomonas maltophilia (strain K279a) GN=pepQ PE=3 SV=1 172 447 2.0E-34
sp|B4EWE3|PEPQ_PROMH Xaa-Pro dipeptidase OS=Proteus mirabilis (strain HI4320) GN=pepQ PE=3 SV=1 49 447 2.0E-34
sp|Q44238|PEPQ_ALTSX Xaa-Pro dipeptidase OS=Alteromonas sp. GN=pepQ PE=1 SV=3 31 451 2.0E-34
sp|B4SI11|PEPQ_STRM5 Xaa-Pro dipeptidase OS=Stenotrophomonas maltophilia (strain R551-3) GN=pepQ PE=3 SV=1 172 450 2.0E-34
sp|Q12TB3|PEPQ_SHEDO Xaa-Pro dipeptidase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pepQ PE=3 SV=1 19 447 2.0E-34
sp|C5BCB6|PEPQ_EDWI9 Xaa-Pro dipeptidase OS=Edwardsiella ictaluri (strain 93-146) GN=pepQ PE=3 SV=1 31 447 4.0E-34
sp|A1S1I9|PEPQ_SHEAM Xaa-Pro dipeptidase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pepQ PE=3 SV=1 19 447 8.0E-34
sp|Q5QVP2|PEPQ2_IDILO Xaa-Pro dipeptidase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pepQ2 PE=3 SV=1 158 454 1.0E-33
sp|P0A3Z4|AMPP2_STRLI Xaa-Pro aminopeptidase 2 OS=Streptomyces lividans GN=pepP2 PE=3 SV=1 49 462 2.0E-33
sp|P0A3Z3|AMPP2_STRCO Xaa-Pro aminopeptidase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pepP2 PE=3 SV=1 49 462 2.0E-33
sp|B0RP90|PEPQ_XANCB Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pepQ PE=3 SV=1 168 450 2.0E-33
sp|A7MQN9|PEPQ_CROS8 Xaa-Pro dipeptidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pepQ PE=3 SV=1 49 451 3.0E-33
sp|A0KEL3|PEPQ_AERHH Xaa-Pro dipeptidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pepQ PE=3 SV=1 32 447 3.0E-33
sp|Q8P5S9|PEPQ_XANCP Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pepQ PE=3 SV=1 168 450 5.0E-33
sp|Q4UY33|PEPQ_XANC8 Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pepQ PE=3 SV=1 168 450 5.0E-33
sp|Q8PH57|PEPQ_XANAC Xaa-Pro dipeptidase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pepQ PE=3 SV=1 168 450 6.0E-33
sp|Q3BPR2|PEPQ_XANC5 Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pepQ PE=3 SV=1 168 450 1.0E-32
sp|Q5H3T0|PEPQ_XANOR Xaa-Pro dipeptidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pepQ PE=3 SV=2 168 450 2.0E-32
sp|Q2P6N8|PEPQ_XANOM Xaa-Pro dipeptidase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pepQ PE=3 SV=1 168 450 2.0E-32
sp|A9MYB1|PEPQ_SALPB Xaa-Pro dipeptidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pepQ PE=3 SV=1 49 451 4.0E-32
sp|Q6DAP4|PEPQ_PECAS Xaa-Pro dipeptidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pepQ PE=3 SV=1 85 447 5.0E-32
sp|C6DI64|PEPQ_PECCP Xaa-Pro dipeptidase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pepQ PE=3 SV=1 49 447 5.0E-32
sp|A3MYG3|PEPQ_ACTP2 Xaa-Pro dipeptidase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pepQ PE=3 SV=1 17 461 5.0E-32
sp|Q7CPD4|PEPQ_SALTY Xaa-Pro dipeptidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|Q9L6L4|PEPQ_SALTI Xaa-Pro dipeptidase OS=Salmonella typhi GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B4TNZ2|PEPQ_SALSV Xaa-Pro dipeptidase OS=Salmonella schwarzengrund (strain CVM19633) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5BIZ1|PEPQ_SALPK Xaa-Pro dipeptidase OS=Salmonella paratyphi A (strain AKU_12601) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|C0Q3F4|PEPQ_SALPC Xaa-Pro dipeptidase OS=Salmonella paratyphi C (strain RKS4594) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|Q5PKQ1|PEPQ_SALPA Xaa-Pro dipeptidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B4SZ86|PEPQ_SALNS Xaa-Pro dipeptidase OS=Salmonella newport (strain SL254) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B4TBS6|PEPQ_SALHS Xaa-Pro dipeptidase OS=Salmonella heidelberg (strain SL476) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5RFL5|PEPQ_SALG2 Xaa-Pro dipeptidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5QW86|PEPQ_SALEP Xaa-Pro dipeptidase OS=Salmonella enteritidis PT4 (strain P125109) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5FNX9|PEPQ_SALDC Xaa-Pro dipeptidase OS=Salmonella dublin (strain CT_02021853) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|Q57HM5|PEPQ_SALCH Xaa-Pro dipeptidase OS=Salmonella choleraesuis (strain SC-B67) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5EZW1|PEPQ_SALA4 Xaa-Pro dipeptidase OS=Salmonella agona (strain SL483) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B8F8H3|PEPQ_HAEPS Xaa-Pro dipeptidase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pepQ PE=3 SV=1 17 447 2.0E-31
sp|A8ACZ6|PEPQ_CITK8 Xaa-Pro dipeptidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pepQ PE=3 SV=1 49 451 2.0E-31
sp|B2VFE3|PEPQ_ERWT9 Xaa-Pro dipeptidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pepQ PE=3 SV=1 49 447 3.0E-31
sp|A9MIX1|PEPQ_SALAR Xaa-Pro dipeptidase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pepQ PE=3 SV=1 49 451 6.0E-31
sp|B5XYG9|PEPQ_KLEP3 Xaa-Pro dipeptidase OS=Klebsiella pneumoniae (strain 342) GN=pepQ PE=3 SV=1 49 451 8.0E-31
sp|A8G8D3|PEPQ_SERP5 Xaa-Pro dipeptidase OS=Serratia proteamaculans (strain 568) GN=pepQ PE=3 SV=1 32 447 8.0E-31
sp|B5YY94|PEPQ_ECO5E Xaa-Pro dipeptidase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pepQ PE=3 SV=1 49 451 1.0E-30
sp|Q8X8I1|PEPQ_ECO57 Xaa-Pro dipeptidase OS=Escherichia coli O157:H7 GN=pepQ PE=3 SV=1 49 451 1.0E-30
sp|B7LTY8|PEPQ_ESCF3 Xaa-Pro dipeptidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|A6TGM5|PEPQ_KLEP7 Xaa-Pro dipeptidase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|Q83PG0|PEPQ_SHIFL Xaa-Pro dipeptidase OS=Shigella flexneri GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|B7NFE8|PEPQ_ECOLU Xaa-Pro dipeptidase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|P21165|PEPQ_ECOLI Xaa-Pro dipeptidase OS=Escherichia coli (strain K12) GN=pepQ PE=1 SV=2 49 451 2.0E-30
sp|B1IW60|PEPQ_ECOLC Xaa-Pro dipeptidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|A8A6V2|PEPQ_ECOHS Xaa-Pro dipeptidase OS=Escherichia coli O9:H4 (strain HS) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|B1XAK9|PEPQ_ECODH Xaa-Pro dipeptidase OS=Escherichia coli (strain K12 / DH10B) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|C5A021|PEPQ_ECOBW Xaa-Pro dipeptidase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|B7L9A5|PEPQ_ECO55 Xaa-Pro dipeptidase OS=Escherichia coli (strain 55989 / EAEC) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|A7ZU52|PEPQ_ECO24 Xaa-Pro dipeptidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|Q0SZ37|PEPQ_SHIF8 Xaa-Pro dipeptidase OS=Shigella flexneri serotype 5b (strain 8401) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|Q32A22|PEPQ_SHIDS Xaa-Pro dipeptidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pepQ PE=3 SV=1 49 451 3.0E-30
sp|Q3YVC0|PEPQ_SHISS Xaa-Pro dipeptidase OS=Shigella sonnei (strain Ss046) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B7N2F3|PEPQ_ECO81 Xaa-Pro dipeptidase OS=Escherichia coli O81 (strain ED1a) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q1R465|PEPQ_ECOUT Xaa-Pro dipeptidase OS=Escherichia coli (strain UTI89 / UPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B1LM33|PEPQ_ECOSM Xaa-Pro dipeptidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q8FBI1|PEPQ_ECOL6 Xaa-Pro dipeptidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q0TAK9|PEPQ_ECOL5 Xaa-Pro dipeptidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|A1AI34|PEPQ_ECOK1 Xaa-Pro dipeptidase OS=Escherichia coli O1:K1 / APEC GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B7MHD2|PEPQ_ECO45 Xaa-Pro dipeptidase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B7UNH5|PEPQ_ECO27 Xaa-Pro dipeptidase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q7MZ93|PEPQ_PHOLL Xaa-Pro dipeptidase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pepQ PE=3 SV=1 49 453 5.0E-30
sp|B7NV19|PEPQ_ECO7I Xaa-Pro dipeptidase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pepQ PE=3 SV=1 49 451 5.0E-30
sp|B6I4I7|PEPQ_ECOSE Xaa-Pro dipeptidase OS=Escherichia coli (strain SE11) GN=pepQ PE=3 SV=1 49 451 5.0E-30
sp|B7M650|PEPQ_ECO8A Xaa-Pro dipeptidase OS=Escherichia coli O8 (strain IAI1) GN=pepQ PE=3 SV=1 49 451 5.0E-30
sp|B3GZT0|PEPQ_ACTP7 Xaa-Pro dipeptidase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pepQ PE=3 SV=1 17 461 6.0E-30
sp|Q31UE2|PEPQ_SHIBS Xaa-Pro dipeptidase OS=Shigella boydii serotype 4 (strain Sb227) GN=pepQ PE=3 SV=1 49 451 1.0E-29
sp|B2TVJ6|PEPQ_SHIB3 Xaa-Pro dipeptidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pepQ PE=3 SV=1 49 451 1.0E-29
sp|A1JIG5|PEPQ_YERE8 Xaa-Pro dipeptidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pepQ PE=3 SV=1 17 451 8.0E-28
sp|A4TR26|PEPQ_YERPP Xaa-Pro dipeptidase OS=Yersinia pestis (strain Pestoides F) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|Q1CN98|PEPQ_YERPN Xaa-Pro dipeptidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|A9R755|PEPQ_YERPG Xaa-Pro dipeptidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|Q0WAP4|PEPQ_YERPE Xaa-Pro dipeptidase OS=Yersinia pestis GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|Q1C2C5|PEPQ_YERPA Xaa-Pro dipeptidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|B1JP62|PEPQ_YERPY Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|Q66FR7|PEPQ_YERPS Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|B2K0Z7|PEPQ_YERPB Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|A7FDF3|PEPQ_YERP3 Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|A4WFX3|PEPQ_ENT38 Xaa-Pro dipeptidase OS=Enterobacter sp. (strain 638) GN=pepQ PE=3 SV=1 131 447 2.0E-27
sp|Q2NWT2|PEPQ_SODGM Xaa-Pro dipeptidase OS=Sodalis glossinidius (strain morsitans) GN=pepQ PE=3 SV=1 150 451 2.0E-27
sp|Q5QXH5|PEPQ1_IDILO Xaa-Pro dipeptidase 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pepQ1 PE=3 SV=1 172 447 4.0E-27
sp|Q2S6U2|PEPQ_HAHCH Xaa-Pro dipeptidase OS=Hahella chejuensis (strain KCTC 2396) GN=pepQ PE=3 SV=1 158 447 5.0E-24
sp|Q8NW55|Y1651_STAAW Uncharacterized peptidase MW1651 OS=Staphylococcus aureus (strain MW2) GN=MW1651 PE=3 SV=1 60 447 6.0E-24
sp|Q99TF5|Y1708_STAAM Uncharacterized peptidase SAV1708 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1708 PE=3 SV=2 60 447 7.0E-24
sp|Q6G8L9|Y1635_STAAS Uncharacterized peptidase SAS1635 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1635 PE=3 SV=1 60 447 7.0E-24
sp|Q7A552|Y1530_STAAN Uncharacterized peptidase SA1530 OS=Staphylococcus aureus (strain N315) GN=SA1530 PE=1 SV=2 60 447 7.0E-24
sp|P81535|PEPQ_PYRFU Xaa-Pro dipeptidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pepQ PE=1 SV=1 60 452 1.0E-23
sp|Q2YTD2|Y1567_STAAB Uncharacterized peptidase SAB1567 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1567 PE=3 SV=2 60 447 1.0E-23
sp|Q6GFZ9|Y1786_STAAR Uncharacterized peptidase SAR1786 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1786 PE=3 SV=1 60 447 3.0E-23
sp|Q2FXL9|Y1816_STAA8 Uncharacterized peptidase SAOUHSC_01816 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01816 PE=3 SV=1 60 447 2.0E-22
sp|Q5HF67|Y1756_STAAC Uncharacterized peptidase SACOL1756 OS=Staphylococcus aureus (strain COL) GN=SACOL1756 PE=3 SV=1 60 447 2.0E-22
sp|Q2FG30|Y1654_STAA3 Uncharacterized peptidase SAUSA300_1654 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1654 PE=3 SV=1 60 447 2.0E-22
sp|Q8CNW9|Y1383_STAES Uncharacterized peptidase SE_1383 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1383 PE=3 SV=2 156 447 1.0E-21
sp|Q5HNJ7|Y1271_STAEQ Uncharacterized peptidase SERP1271 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1271 PE=3 SV=1 156 447 1.0E-21
sp|Q49YD7|Y1059_STAS1 Uncharacterized peptidase SSP1059 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1059 PE=3 SV=1 82 447 6.0E-21
sp|O58885|PEPQ_PYRHO Xaa-Pro dipeptidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pepQ PE=1 SV=1 172 452 1.0E-20
sp|Q4L749|Y1217_STAHJ Uncharacterized peptidase SH1217 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1217 PE=3 SV=1 164 447 4.0E-19
sp|Q58216|Y806_METJA Uncharacterized peptidase MJ0806 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0806 PE=3 SV=1 150 449 2.0E-15
sp|O31689|YKVY_BACSU Putative dipeptidase YkvY OS=Bacillus subtilis (strain 168) GN=ykvY PE=3 SV=1 165 452 5.0E-15
sp|P54518|YQHT_BACSU Uncharacterized peptidase YqhT OS=Bacillus subtilis (strain 168) GN=yqhT PE=3 SV=1 126 452 4.0E-14
sp|B2AW39|AMPP2_PODAN Probable Xaa-Pro aminopeptidase PODANS_7_5850 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_7_5850 PE=3 SV=1 381 456 2.0E-12
sp|O25681|AMPEP_HELPY Aminopeptidase HP_1037 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_1037 PE=1 SV=1 170 446 7.0E-12
sp|P76524|YPDF_ECOLI Aminopeptidase YpdF OS=Escherichia coli (strain K12) GN=ypdF PE=1 SV=1 155 446 4.0E-11
sp|P47566|AMPP_MYCGE Putative Xaa-Pro aminopeptidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pepP PE=3 SV=1 153 438 7.0E-10
sp|Q2HA12|AMPP2_CHAGB Probable Xaa-Pro aminopeptidase CHGG_02942 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_02942 PE=3 SV=1 381 451 1.0E-09
sp|P46545|PEPQ_LACDL Xaa-Pro dipeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pepQ PE=3 SV=1 155 452 2.0E-09
sp|Q9S6S1|PEPQ_LACDE Xaa-Pro dipeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pepQ PE=1 SV=1 155 452 2.0E-09
sp|P75313|AMPP_MYCPN Putative Xaa-Pro aminopeptidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pepP PE=3 SV=1 174 438 8.0E-09
sp|Q9UUD8|YOD1_SCHPO Uncharacterized peptidase C18A7.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.01 PE=3 SV=1 154 397 3.0E-08
sp|O84913|PEPQ_LACHE Xaa-Pro dipeptidase OS=Lactobacillus helveticus GN=pepQ PE=3 SV=1 157 452 4.0E-06
sp|P9WHS7|PEPE_MYCTU Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pepE PE=1 SV=1 147 452 9.0E-06
sp|P9WHS6|PEPE_MYCTO Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pepE PE=3 SV=1 147 452 9.0E-06
sp|P65811|PEPE_MYCBO Probable dipeptidase PepE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pepE PE=3 SV=1 147 452 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030145 manganese ion binding Yes
GO:0070006 metalloaminopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0008235 metalloexopeptidase activity No
GO:0005488 binding No
GO:0008237 metallopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0004177 aminopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008238 exopeptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 137.69 73.27 202.11
CcL In ants, during behavior modification 106.75 57.72 155.77
CcD In ants, recently dead 127.47 67.82 187.12

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.285523 no
SC16a CcD 0.784800 no
CcL CcD 0.478996 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6975
MTDFETALKAKYPAKAHARRIVELLRDTIPDLGGVLYLEGRATRMQEDNDSPEPFRQRRHFYYLTGCNLADCRFA
YDIAADHSVLFIPPVDPDDVLWSGLPVSAEEALGRYDVDEVCYTTDVNATLARLAGQQKTAKGTAFAMAGHVSDS
VTFLEFDATDVTALKSAIDRARVVKDAHEVAMMRKANHISGLAHAAVVRRARHAELERELEAVFLERCVALGARE
MAYHPILAAGRAAATLHYVDNDARLGGKLNLLIDAGAEWDNYASDITRTFPLSGSFTKESRAIYDIVLNMQTECI
GLVKAGALWDDIHLHAHKVAIDGLLSLGLLKGDAREILEARTSAAFFPHGLGHYLGMDTHDVGGNPDRNDKDVLF
RYLRLRGQIPAGSVVTVEPGIYFCEFIIKPYLDHPVHGQYIDRAVLDRYWDVGGVRIEDNVLVTAGGCENLTTAI
KEPGEVEALVSQG
Coding >Ophio5|6975
ATGACCGACTTCGAGACGGCCCTCAAGGCCAAGTATCCGGCCAAGGCGCACGCGCGCCGCATCGTCGAGTTGCTG
CGCGACACCATTCCCGATCTCGGCGGCGTTCTCTATCTCGAGGGCCGCGCGACCCGGATGCAGGAGGACAATGAC
TCACCGGAGCCTTTCCGCCAGCGTCGACACTTCTACTACCTCACCGGCTGCAACCTCGCCGACTGCCGCTTCGCC
TACGACATCGCCGCCGACCACTCCGTCCTCTTCATCCCACCTGTCGACCCGGACGATGTGCTCTGGTCCGGCCTG
CCGGTCAGTGCCGAAGAGGCCCTCGGCCGCTACGACGTCGACGAGGTGTGTTACACCACCGACGTCAACGCCACG
CTCGCCCGTCTGGCCGGGCAGCAGAAGACAGCGAAGGGAACGGCCTTTGCCATGGCCGGCCACGTTTCCGACAGC
GTCACCTTTCTCGAGTTCGACGCGACCGACGTGACGGCCCTCAAGTCGGCCATTGATCGCGCCCGCGTCGTCAAG
GACGCTCACGAGGTCGCCATGATGCGCAAGGCAAACCACATATCCGGTCTGGCCCACGCTGCCGTCGTCCGTCGC
GCACGCCATGCCGAGCTTGAGCGTGAGCTCGAGGCTGTCTTCCTCGAGCGCTGCGTCGCCCTCGGTGCTCGCGAG
ATGGCCTACCACCCGATTCTCGCTGCCGGCCGCGCCGCTGCTACGCTGCACTACGTCGACAACGATGCTCGCCTC
GGCGGCAAGCTGAACTTGCTGATCGACGCCGGCGCCGAGTGGGACAACTATGCTTCCGACATTACGAGAACCTTT
CCCCTGTCCGGCTCCTTTACCAAAGAATCGCGCGCCATTTACGACATTGTGCTGAACATGCAGACCGAGTGCATC
GGCCTCGTCAAGGCCGGCGCGCTGTGGGATGATATTCACCTGCACGCCCATAAGGTGGCCATCGACGGTCTGCTA
TCGCTCGGCCTCCTCAAGGGCGATGCTCGTGAGATTCTCGAGGCCCGAACCAGCGCCGCCTTCTTCCCCCACGGC
CTGGGCCATTACCTCGGCATGGACACCCACGACGTCGGAGGCAATCCCGACCGCAATGACAAGGACGTGCTCTTC
CGCTACCTGCGACTCCGCGGCCAAATCCCCGCGGGTAGCGTCGTCACTGTCGAGCCAGGGATATATTTTTGCGAA
TTCATCATAAAGCCATATCTTGACCACCCTGTCCACGGGCAGTACATCGACCGCGCCGTCTTGGACAGGTATTGG
GACGTCGGCGGTGTTCGCATCGAGGACAATGTCCTCGTCACCGCCGGCGGCTGCGAGAATCTGACGACGGCGATC
AAGGAGCCCGGTGAGGTTGAGGCTCTCGTTTCTCAAGGC
Transcript >Ophio5|6975
ATGACCGACTTCGAGACGGCCCTCAAGGCCAAGTATCCGGCCAAGGCGCACGCGCGCCGCATCGTCGAGTTGCTG
CGCGACACCATTCCCGATCTCGGCGGCGTTCTCTATCTCGAGGGCCGCGCGACCCGGATGCAGGAGGACAATGAC
TCACCGGAGCCTTTCCGCCAGCGTCGACACTTCTACTACCTCACCGGCTGCAACCTCGCCGACTGCCGCTTCGCC
TACGACATCGCCGCCGACCACTCCGTCCTCTTCATCCCACCTGTCGACCCGGACGATGTGCTCTGGTCCGGCCTG
CCGGTCAGTGCCGAAGAGGCCCTCGGCCGCTACGACGTCGACGAGGTGTGTTACACCACCGACGTCAACGCCACG
CTCGCCCGTCTGGCCGGGCAGCAGAAGACAGCGAAGGGAACGGCCTTTGCCATGGCCGGCCACGTTTCCGACAGC
GTCACCTTTCTCGAGTTCGACGCGACCGACGTGACGGCCCTCAAGTCGGCCATTGATCGCGCCCGCGTCGTCAAG
GACGCTCACGAGGTCGCCATGATGCGCAAGGCAAACCACATATCCGGTCTGGCCCACGCTGCCGTCGTCCGTCGC
GCACGCCATGCCGAGCTTGAGCGTGAGCTCGAGGCTGTCTTCCTCGAGCGCTGCGTCGCCCTCGGTGCTCGCGAG
ATGGCCTACCACCCGATTCTCGCTGCCGGCCGCGCCGCTGCTACGCTGCACTACGTCGACAACGATGCTCGCCTC
GGCGGCAAGCTGAACTTGCTGATCGACGCCGGCGCCGAGTGGGACAACTATGCTTCCGACATTACGAGAACCTTT
CCCCTGTCCGGCTCCTTTACCAAAGAATCGCGCGCCATTTACGACATTGTGCTGAACATGCAGACCGAGTGCATC
GGCCTCGTCAAGGCCGGCGCGCTGTGGGATGATATTCACCTGCACGCCCATAAGGTGGCCATCGACGGTCTGCTA
TCGCTCGGCCTCCTCAAGGGCGATGCTCGTGAGATTCTCGAGGCCCGAACCAGCGCCGCCTTCTTCCCCCACGGC
CTGGGCCATTACCTCGGCATGGACACCCACGACGTCGGAGGCAATCCCGACCGCAATGACAAGGACGTGCTCTTC
CGCTACCTGCGACTCCGCGGCCAAATCCCCGCGGGTAGCGTCGTCACTGTCGAGCCAGGGATATATTTTTGCGAA
TTCATCATAAAGCCATATCTTGACCACCCTGTCCACGGGCAGTACATCGACCGCGCCGTCTTGGACAGGTATTGG
GACGTCGGCGGTGTTCGCATCGAGGACAATGTCCTCGTCACCGCCGGCGGCTGCGAGAATCTGACGACGGCGATC
AAGGAGCCCGGTGAGGTTGAGGCTCTCGTTTCTCAAGGCTGA
Gene >Ophio5|6975
ATGACCGACTTCGAGACGGCCCTCAAGGCCAAGTATCCGGCCAAGGCGCACGCGCGCCGCATCGTCGAGTTGCTG
CGCGACACCATTCCCGATCTCGGCGGCGTTCTCTATCTCGAGGGCCGCGCGACCCGGATGCAGGAGGACAATGAC
TCACCGGAGCCTTTCCGGTAAGCCTACTTGGAGCCATCTTCACCCTTACTGAAGCTGGAGCAGCCAGCGTCGACA
CTTCTACTACCTCACCGGCTGCAACCTCGCCGACTGCCGCTTCGCCTACGACATCGCCGCCGACCACTCCGTCCT
CTTCATCCCACCTGTCGACCCGGACGATGTGCTCTGGTCCGGCCTGCCGGTCAGTGCCGAAGAGGCCCTCGGCCG
CTACGACGTCGACGAGGTGTGTTACACCACCGACGTCAACGCCACGCTCGCCCGTCTGGCCGGGCAGCAGAAGAC
AGCGAAGGGAACGGCCTTTGCCATGGCCGGCCACGTTTCCGACAGCGTCACCTTTCTCGAGTTCGACGCGACCGA
CGTGACGGCCCTCAAGTCGGCCATTGATCGCGCCCGCGTCGTCAAGGACGCTCACGAGGTCGCCATGATGCGCAA
GGCAAACCACATATCCGGTCTGGCCCACGCTGCCGTCGTCCGTCGCGCACGCCATGCCGAGCTTGAGCGTGAGCT
CGAGGCTGTCTTCCTCGAGCGCTGCGTCGCCCTCGGTGCTCGCGAGATGGCCTACCACCCGATTCTCGCTGCCGG
CCGCGCCGCTGCTACGCTGCACTACGTCGACAACGATGCTCGCCTCGGCGGCAAGCTGAACTTGCTGATCGACGC
CGGCGCCGAGTGGGACAACTATGCTTCCGACATTGTCAGACTCAAGACGCCCCTCCGACTGGCTTGTTTTTTTTT
TGGCATGGCTGACCGACTTAGACGAGAACCTTTCCCCTGTCCGGCTCCTTTACCAAAGAATCGCGCGCCATTTAC
GACATTGTGCTGAACATGCAGACCGAGTGCATCGGCCTCGTCAAGGCCGGCGCGCTGTGGGATGATATTCACCTG
CACGCCCATAAGGTGGCCATCGACGGTCTGCTATCGCTCGGCCTCCTCAAGGGCGATGCTCGTGAGATTCTCGAG
GCCCGAACCAGCGCCGCCTTCTTCCCCCACGGCCTGGGCCATTACCTCGGCATGGACACCCACGACGTCGGAGGC
AATCCCGACCGCAATGACAAGGACGTGCTCTTCCGCTACCTGCGACTCCGCGGCCAAATCCCCGCGGGTAGCGTC
GTCACTGTCGAGCCAGGGGTGCGCTGAGACCTGTGTCTGTTCTTCTCTTGCTTTTATTCTTCCTGTGCTAAAAGG
CCGTCTGCAGATATATTTTTGCGAATTCATCATAAAGCCATATCTTGACCACCCTGTCCACGGGCAGTACATCGA
CCGCGCCGTCTTGGACAGGTATTGGGACGTCGGCGGTGTTCGGTGAGTTGGGCTGACAACTCTGTTTGCCATTTG
TCGCTGACTCTGTGCGTCTACATCTACAGCATCGAGGACAATGTCCTCGTCACCGCCGGCGGCTGCGAGAATCTG
ACGACGGCGATCAAGGAGCCCGGTGAGGTTGAGGCTCTCGTTTCTCAAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail