Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6975
Gene name
Locationscaffold_64:13644..15273
Strand+
Gene length (bp)1629
Transcript length (bp)1392
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 1.9E-56 182 440
PF05195 AMP_N Aminopeptidase P, N-terminal domain 8.2E-23 20 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9EK74|AMPP3_METRA Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|E9DV56|AMPP3_METAQ Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium acridum (strain CQMa 102) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|C7Z837|AMPP2_NECH7 Probable Xaa-Pro aminopeptidase NECHADRAFT_60613 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_60613 PE=3 SV=1 3 462 0.0E+00
sp|A7UWH7|AMPP2_NEUCR Probable Xaa-Pro aminopeptidase NCU11288 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11288 PE=3 SV=1 3 463 0.0E+00
sp|D1ZQL9|AMPP2_SORMK Probable Xaa-Pro aminopeptidase SMAC_04549 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_04549 PE=3 SV=1 3 463 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9EK74|AMPP3_METRA Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|E9DV56|AMPP3_METAQ Probable Xaa-Pro aminopeptidase pepP OS=Metarhizium acridum (strain CQMa 102) GN=pepP PE=3 SV=1 3 462 0.0E+00
sp|C7Z837|AMPP2_NECH7 Probable Xaa-Pro aminopeptidase NECHADRAFT_60613 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_60613 PE=3 SV=1 3 462 0.0E+00
sp|A7UWH7|AMPP2_NEUCR Probable Xaa-Pro aminopeptidase NCU11288 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11288 PE=3 SV=1 3 463 0.0E+00
sp|D1ZQL9|AMPP2_SORMK Probable Xaa-Pro aminopeptidase SMAC_04549 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_04549 PE=3 SV=1 3 463 0.0E+00
sp|E3QYP0|AMPP3_COLGM Probable Xaa-Pro aminopeptidase PEPP OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=PEPP PE=3 SV=1 3 461 0.0E+00
sp|B2AFW1|AMPP3_PODAN Probable Xaa-Pro aminopeptidase PEPP OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PEPP PE=3 SV=1 3 463 0.0E+00
sp|C9SDK8|AMPP2_VERA1 Probable Xaa-Pro aminopeptidase VDBG_02538 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_02538 PE=3 SV=1 1 460 0.0E+00
sp|A4RAE9|AMPP3_MAGO7 Probable Xaa-Pro aminopeptidase PEPP OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PEPP PE=3 SV=1 3 463 0.0E+00
sp|A6SDE9|AMPP3_BOTFB Probable Xaa-Pro aminopeptidase pepP OS=Botryotinia fuckeliana (strain B05.10) GN=pepP PE=3 SV=1 5 463 0.0E+00
sp|A7EUB3|AMPP3_SCLS1 Probable Xaa-Pro aminopeptidase pepP OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pepP PE=3 SV=1 8 461 0.0E+00
sp|C7YVN8|AMPP3_NECH7 Probable Xaa-Pro aminopeptidase PEPP OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PEPP PE=3 SV=1 3 460 0.0E+00
sp|B8M0Z4|AMPP3_TALSN Probable Xaa-Pro aminopeptidase pepP OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|B6Q8T5|AMPP3_TALMQ Probable Xaa-Pro aminopeptidase pepP OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|Q96WX8|AMPP3_EMENI Probable Xaa-Pro aminopeptidase pepP OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pepP PE=3 SV=2 1 461 0.0E+00
sp|A2QKF6|AMPP3_ASPNC Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|Q0U6G5|AMPP3_PHANO Probable Xaa-Pro aminopeptidase PEPP OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PEPP PE=3 SV=1 3 463 0.0E+00
sp|C5PHM7|AMPP3_COCP7 Probable Xaa-Pro aminopeptidase PEPP OS=Coccidioides posadasii (strain C735) GN=PEPP PE=3 SV=1 8 463 0.0E+00
sp|A1CSI0|AMPP3_ASPCL Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|B6H2M0|AMPP3_PENRW Probable Xaa-Pro aminopeptidase pepP OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|E9DDK8|AMPP3_COCPS Probable Xaa-Pro aminopeptidase PEPP OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=PEPP PE=3 SV=1 8 463 0.0E+00
sp|Q4X267|AMPP3_ASPFU Probable Xaa-Pro aminopeptidase pepP OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|B0XW47|AMPP3_ASPFC Probable Xaa-Pro aminopeptidase pepP OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pepP PE=3 SV=1 1 461 0.0E+00
sp|A1DG66|AMPP3_NEOFI Probable Xaa-Pro aminopeptidase pepP OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|B8NC10|AMPP3_ASPFN Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|B2WMQ2|AMPP3_PYRTR Probable Xaa-Pro aminopeptidase pepP OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pepP PE=3 SV=1 3 460 0.0E+00
sp|C0NIF0|AMPP3_AJECG Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|C6H7R7|AMPP3_AJECH Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces capsulatus (strain H143) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|Q0CFZ0|AMPP3_ASPTN Probable Xaa-Pro aminopeptidase pepP OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pepP PE=3 SV=1 1 459 0.0E+00
sp|C5JQ04|AMPP3_AJEDS Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces dermatitidis (strain SLH14081) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|C5G874|AMPP3_AJEDR Probable Xaa-Pro aminopeptidase PEPP OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PEPP PE=3 SV=1 8 461 0.0E+00
sp|E3S6N7|AMPP3_PYRTT Probable Xaa-Pro aminopeptidase pepP OS=Pyrenophora teres f. teres (strain 0-1) GN=pepP PE=3 SV=1 3 460 0.0E+00
sp|D5GHP2|AMPP2_TUBMM Probable Xaa-Pro aminopeptidase GSTUM_00008071001 OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00008071001 PE=3 SV=1 8 452 0.0E+00
sp|C1H9Q9|AMPP3_PARBA Probable Xaa-Pro aminopeptidase PEPP OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PEPP PE=3 SV=1 5 462 0.0E+00
sp|C1GD57|AMPP3_PARBD Probable Xaa-Pro aminopeptidase PEPP OS=Paracoccidioides brasiliensis (strain Pb18) GN=PEPP PE=3 SV=1 11 462 1.0E-180
sp|C0SHQ0|AMPP3_PARBP Probable Xaa-Pro aminopeptidase PEPP OS=Paracoccidioides brasiliensis (strain Pb03) GN=PEPP PE=3 SV=1 11 462 4.0E-180
sp|C4JF09|AMPP3_UNCRE Probable Xaa-Pro aminopeptidase PEPP OS=Uncinocarpus reesii (strain UAMH 1704) GN=PEPP PE=3 SV=1 8 463 6.0E-180
sp|E4ZHV7|AMPP3_LEPMJ Probable Xaa-Pro aminopeptidase PEPP OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=PEPP PE=3 SV=1 3 463 1.0E-179
sp|E3Q897|AMPP2_COLGM Probable Xaa-Pro aminopeptidase GLRG_02280 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_02280 PE=3 SV=1 8 448 1.0E-119
sp|P43590|YFH6_YEAST Uncharacterized peptidase YFR006W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFR006W PE=1 SV=1 11 463 7.0E-116
sp|B2WKR4|AMPP2_PYRTR Probable Xaa-Pro aminopeptidase PTRG_10574 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_10574 PE=3 SV=1 2 451 5.0E-111
sp|E9F9J8|AMPP2_METRA Probable Xaa-Pro aminopeptidase MAA_08947 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=MAA_08947 PE=3 SV=2 5 451 9.0E-110
sp|A6SL16|AMPP2_BOTFB Probable Xaa-Pro aminopeptidase BC1G_13431 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_13431 PE=3 SV=1 3 451 1.0E-109
sp|E3RNJ5|AMPP2_PYRTT Probable Xaa-Pro aminopeptidase PTT_10145 OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_10145 PE=3 SV=1 11 451 4.0E-109
sp|A4RQ11|AMPP2_MAGO7 Probable Xaa-Pro aminopeptidase MGG_05684 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05684 PE=3 SV=1 11 451 2.0E-108
sp|C5GKT2|AMPP2_AJEDR Probable Xaa-Pro aminopeptidase BDCG_04966 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_04966 PE=3 SV=1 11 463 2.0E-108
sp|C5K0R2|AMPP2_AJEDS Probable Xaa-Pro aminopeptidase BDBG_08406 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_08406 PE=3 SV=1 11 463 4.0E-108
sp|E9E2J4|AMPP2_METAQ Probable Xaa-Pro aminopeptidase MAC_04092 OS=Metarhizium acridum (strain CQMa 102) GN=MAC_04092 PE=3 SV=1 3 451 1.0E-107
sp|A7ENP9|AMPP2_SCLS1 Probable Xaa-Pro aminopeptidase SS1G_06948 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_06948 PE=3 SV=1 3 451 2.0E-107
sp|B8M2W9|AMPP2_TALSN Probable Xaa-Pro aminopeptidase TSTA_094700 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_094700 PE=3 SV=1 11 451 6.0E-104
sp|C0NF18|AMPP2_AJECG Probable Xaa-Pro aminopeptidase HCBG_01484 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_01484 PE=3 SV=1 11 463 2.0E-103
sp|A6QYF6|AMPP2_AJECN Probable Xaa-Pro aminopeptidase HCAG_02413 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_02413 PE=3 SV=1 11 463 1.0E-102
sp|C1H3X3|AMPP2_PARBA Probable Xaa-Pro aminopeptidase PAAG_05466 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_05466 PE=3 SV=2 11 451 2.0E-102
sp|C6HNY5|AMPP2_AJECH Probable Xaa-Pro aminopeptidase HCDG_07916 OS=Ajellomyces capsulatus (strain H143) GN=HCDG_07916 PE=3 SV=1 11 463 5.0E-102
sp|Q0CZM6|AMPP2_ASPTN Probable Xaa-Pro aminopeptidase ATEG_00858 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_00858 PE=3 SV=1 11 451 9.0E-102
sp|E9CY14|AMPP2_COCPS Probable Xaa-Pro aminopeptidase CPSG_02684 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02684 PE=3 SV=1 11 451 9.0E-102
sp|C5PAH2|AMPP2_COCP7 Probable Xaa-Pro aminopeptidase CPC735_009100 OS=Coccidioides posadasii (strain C735) GN=CPC735_009100 PE=3 SV=1 11 451 1.0E-101
sp|A1D1S6|AMPP2_NEOFI Probable Xaa-Pro aminopeptidase NFIA_010500 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_010500 PE=3 SV=1 11 451 6.0E-101
sp|A1CNW6|AMPP2_ASPCL Probable Xaa-Pro aminopeptidase ACLA_020440 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_020440 PE=3 SV=1 11 459 6.0E-101
sp|D1ZBF6|AMPP3_SORMK Probable Xaa-Pro aminopeptidase PEPP OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PEPP PE=3 SV=1 3 451 9.0E-101
sp|D4D6B8|AMPP2_TRIVH Probable Xaa-Pro aminopeptidase TRV_02643 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02643 PE=3 SV=1 4 451 2.0E-100
sp|D4B0B2|AMPP2_ARTBC Probable Xaa-Pro aminopeptidase ARB_01886 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01886 PE=3 SV=1 4 451 2.0E-99
sp|A2QAW7|AMPP2_ASPNC Probable Xaa-Pro aminopeptidase An01g13040 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g13040 PE=3 SV=1 11 451 4.0E-99
sp|C0SDW6|AMPP2_PARBP Probable Xaa-Pro aminopeptidase PABG_05921 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_05921 PE=3 SV=1 11 451 8.0E-99
sp|C1GHS9|AMPP2_PARBD Probable Xaa-Pro aminopeptidase PADG_06815 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_06815 PE=3 SV=2 11 451 8.0E-99
sp|Q5BF48|AMPP2_EMENI Probable Xaa-Pro aminopeptidase AN0832 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0832 PE=3 SV=1 11 459 3.0E-97
sp|E4V1Q7|AMPP2_ARTGP Probable Xaa-Pro aminopeptidase MGYG_06974 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_06974 PE=3 SV=1 11 451 3.0E-97
sp|B6HAN0|AMPP2_PENRW Probable Xaa-Pro aminopeptidase Pc16g13390 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc16g13390 PE=3 SV=1 15 451 8.0E-97
sp|Q2UQH9|AMPP2_ASPOR Probable Xaa-Pro aminopeptidase AO090005001240 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005001240 PE=3 SV=1 11 451 2.0E-94
sp|Q4WRV9|AMPP2_ASPFU Probable Xaa-Pro aminopeptidase AFUA_1G14920 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G14920 PE=3 SV=1 11 451 5.0E-94
sp|B0XN37|AMPP2_ASPFC Probable Xaa-Pro aminopeptidase AFUB_014460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_014460 PE=3 SV=1 11 451 5.0E-94
sp|Q0V147|AMPP2_PHANO Probable Xaa-Pro aminopeptidase SNOG_02267 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02267 PE=3 SV=2 5 451 3.0E-92
sp|B8MZI5|AMPP2_ASPFN Probable Xaa-Pro aminopeptidase AFLA_084750 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_084750 PE=3 SV=1 14 451 2.0E-91
sp|B2AW39|AMPP2_PODAN Probable Xaa-Pro aminopeptidase PODANS_7_5850 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_7_5850 PE=3 SV=1 9 364 3.0E-90
sp|C5FUV0|AMPP2_ARTOC Probable Xaa-Pro aminopeptidase MCYG_06503 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_06503 PE=3 SV=1 11 451 2.0E-85
sp|C4JY72|AMPP2_UNCRE Probable Xaa-Pro aminopeptidase UREG_07123 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07123 PE=3 SV=1 64 451 4.0E-84
sp|Q2HA12|AMPP2_CHAGB Probable Xaa-Pro aminopeptidase CHGG_02942 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_02942 PE=3 SV=1 11 365 2.0E-81
sp|C9SEV5|AMPP3_VERA1 Probable Xaa-Pro aminopeptidase PEPP OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=PEPP PE=3 SV=1 11 451 4.0E-76
sp|B6QAW7|AMPP2_TALMQ Probable Xaa-Pro aminopeptidase PMAA_074180 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_074180 PE=3 SV=1 99 451 3.0E-75
sp|P12955|PEPD_HUMAN Xaa-Pro dipeptidase OS=Homo sapiens GN=PEPD PE=1 SV=3 19 461 2.0E-67
sp|Q11136|PEPD_MOUSE Xaa-Pro dipeptidase OS=Mus musculus GN=Pepd PE=1 SV=3 19 461 5.0E-66
sp|Q5RFB3|PEPD_PONAB Xaa-Pro dipeptidase OS=Pongo abelii GN=PEPD PE=2 SV=1 19 461 6.0E-66
sp|Q5I0D7|PEPD_RAT Xaa-Pro dipeptidase OS=Rattus norvegicus GN=Pepd PE=2 SV=1 19 461 7.0E-66
sp|Q55E60|PEPD_DICDI Xaa-Pro dipeptidase OS=Dictyostelium discoideum GN=pepd PE=1 SV=1 20 460 1.0E-65
sp|P44881|AMPP_HAEIN Xaa-Pro aminopeptidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pepP PE=3 SV=1 4 461 2.0E-59
sp|P15034|AMPP_ECOLI Xaa-Pro aminopeptidase OS=Escherichia coli (strain K12) GN=pepP PE=1 SV=2 19 460 1.0E-55
sp|A1TXT7|PEPQ_MARHV Xaa-Pro dipeptidase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pepQ PE=3 SV=1 172 447 2.0E-42
sp|A0KR51|PEPQ_SHESA Xaa-Pro dipeptidase OS=Shewanella sp. (strain ANA-3) GN=pepQ PE=3 SV=1 19 447 1.0E-41
sp|Q0I0T2|PEPQ_SHESR Xaa-Pro dipeptidase OS=Shewanella sp. (strain MR-7) GN=pepQ PE=3 SV=1 19 447 2.0E-41
sp|Q0HPB6|PEPQ_SHESM Xaa-Pro dipeptidase OS=Shewanella sp. (strain MR-4) GN=pepQ PE=3 SV=1 19 447 2.0E-40
sp|A6WHA1|PEPQ_SHEB8 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS185) GN=pepQ PE=3 SV=1 19 447 2.0E-40
sp|Q8EKR8|PEPQ_SHEON Xaa-Pro dipeptidase OS=Shewanella oneidensis (strain MR-1) GN=pepQ PE=3 SV=1 19 447 2.0E-40
sp|Q9NQH7|XPP3_HUMAN Probable Xaa-Pro aminopeptidase 3 OS=Homo sapiens GN=XPNPEP3 PE=1 SV=1 49 463 2.0E-40
sp|A1RDW7|PEPQ_SHESW Xaa-Pro dipeptidase OS=Shewanella sp. (strain W3-18-1) GN=pepQ PE=3 SV=1 19 447 4.0E-40
sp|A4Y1B7|PEPQ_SHEPC Xaa-Pro dipeptidase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pepQ PE=3 SV=1 19 447 4.0E-40
sp|A9KU92|PEPQ_SHEB9 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS195) GN=pepQ PE=3 SV=1 19 447 5.0E-40
sp|B8E3R4|PEPQ_SHEB2 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS223) GN=pepQ PE=3 SV=1 19 447 7.0E-40
sp|A3CYJ5|PEPQ_SHEB5 Xaa-Pro dipeptidase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pepQ PE=3 SV=1 19 450 1.0E-39
sp|B7ZMP1|XPP3_MOUSE Probable Xaa-Pro aminopeptidase 3 OS=Mus musculus GN=Xpnpep3 PE=1 SV=1 49 462 2.0E-39
sp|Q5R9W8|XPP3_PONAB Probable Xaa-Pro aminopeptidase 3 OS=Pongo abelii GN=XPNPEP3 PE=2 SV=1 49 463 2.0E-39
sp|Q54T46|XPP3_DICDI Probable Xaa-Pro aminopeptidase 3 OS=Dictyostelium discoideum GN=xpnpep3 PE=2 SV=1 50 462 5.0E-39
sp|P0A3Z2|AMPP1_STRLI Xaa-Pro aminopeptidase 1 OS=Streptomyces lividans GN=pepPI PE=1 SV=2 49 461 7.0E-39
sp|P0A3Z1|AMPP1_STRCO Xaa-Pro aminopeptidase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pepPI PE=3 SV=2 49 461 7.0E-39
sp|A3Q8U5|PEPQ_SHELP Xaa-Pro dipeptidase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pepQ PE=3 SV=1 19 447 1.0E-38
sp|B5DEQ3|XPP3_RAT Probable Xaa-Pro aminopeptidase 3 OS=Rattus norvegicus GN=Xpnpep3 PE=1 SV=1 48 462 2.0E-37
sp|B8CHA2|PEPQ_SHEPW Xaa-Pro dipeptidase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=pepQ PE=3 SV=1 31 447 1.0E-36
sp|A8GYG1|PEPQ_SHEPA Xaa-Pro dipeptidase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pepQ PE=3 SV=1 141 447 3.0E-36
sp|Q48AT5|PEPQ_COLP3 Xaa-Pro dipeptidase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pepQ PE=3 SV=1 1 447 4.0E-36
sp|Q3IJ21|PEPQ_PSEHT Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pepQ PE=3 SV=1 32 447 1.0E-35
sp|A8FP64|PEPQ_SHESH Xaa-Pro dipeptidase OS=Shewanella sediminis (strain HAW-EB3) GN=pepQ PE=3 SV=1 19 447 1.0E-35
sp|A4STF0|PEPQ_AERS4 Xaa-Pro dipeptidase OS=Aeromonas salmonicida (strain A449) GN=pepQ PE=3 SV=1 49 447 3.0E-35
sp|Q15ZF7|PEPQ_PSEA6 Xaa-Pro dipeptidase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pepQ PE=3 SV=1 32 447 4.0E-35
sp|Q10439|ICP55_SCHPO Intermediate cleaving peptidase 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=icp55 PE=3 SV=2 55 459 5.0E-35
sp|P40051|ICP55_YEAST Intermediate cleaving peptidase 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICP55 PE=1 SV=1 54 463 8.0E-35
sp|B0TLC0|PEPQ_SHEHH Xaa-Pro dipeptidase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pepQ PE=3 SV=1 19 447 8.0E-35
sp|B1KCZ4|PEPQ_SHEWM Xaa-Pro dipeptidase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pepQ PE=3 SV=1 20 447 8.0E-35
sp|P77814|PEPQ_PSEHA Xaa-Pro dipeptidase OS=Pseudoalteromonas haloplanktis GN=pepQ PE=1 SV=1 32 447 1.0E-34
sp|Q08A38|PEPQ_SHEFN Xaa-Pro dipeptidase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pepQ PE=3 SV=1 19 447 1.0E-34
sp|B2FT23|PEPQ_STRMK Xaa-Pro dipeptidase OS=Stenotrophomonas maltophilia (strain K279a) GN=pepQ PE=3 SV=1 172 447 2.0E-34
sp|B4EWE3|PEPQ_PROMH Xaa-Pro dipeptidase OS=Proteus mirabilis (strain HI4320) GN=pepQ PE=3 SV=1 49 447 2.0E-34
sp|Q44238|PEPQ_ALTSX Xaa-Pro dipeptidase OS=Alteromonas sp. GN=pepQ PE=1 SV=3 31 451 2.0E-34
sp|B4SI11|PEPQ_STRM5 Xaa-Pro dipeptidase OS=Stenotrophomonas maltophilia (strain R551-3) GN=pepQ PE=3 SV=1 172 450 2.0E-34
sp|Q12TB3|PEPQ_SHEDO Xaa-Pro dipeptidase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pepQ PE=3 SV=1 19 447 2.0E-34
sp|C5BCB6|PEPQ_EDWI9 Xaa-Pro dipeptidase OS=Edwardsiella ictaluri (strain 93-146) GN=pepQ PE=3 SV=1 31 447 4.0E-34
sp|A1S1I9|PEPQ_SHEAM Xaa-Pro dipeptidase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pepQ PE=3 SV=1 19 447 8.0E-34
sp|Q5QVP2|PEPQ2_IDILO Xaa-Pro dipeptidase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pepQ2 PE=3 SV=1 158 454 1.0E-33
sp|P0A3Z4|AMPP2_STRLI Xaa-Pro aminopeptidase 2 OS=Streptomyces lividans GN=pepP2 PE=3 SV=1 49 462 2.0E-33
sp|P0A3Z3|AMPP2_STRCO Xaa-Pro aminopeptidase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pepP2 PE=3 SV=1 49 462 2.0E-33
sp|B0RP90|PEPQ_XANCB Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pepQ PE=3 SV=1 168 450 2.0E-33
sp|A7MQN9|PEPQ_CROS8 Xaa-Pro dipeptidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pepQ PE=3 SV=1 49 451 3.0E-33
sp|A0KEL3|PEPQ_AERHH Xaa-Pro dipeptidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pepQ PE=3 SV=1 32 447 3.0E-33
sp|Q8P5S9|PEPQ_XANCP Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pepQ PE=3 SV=1 168 450 5.0E-33
sp|Q4UY33|PEPQ_XANC8 Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pepQ PE=3 SV=1 168 450 5.0E-33
sp|Q8PH57|PEPQ_XANAC Xaa-Pro dipeptidase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pepQ PE=3 SV=1 168 450 6.0E-33
sp|Q3BPR2|PEPQ_XANC5 Xaa-Pro dipeptidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pepQ PE=3 SV=1 168 450 1.0E-32
sp|Q5H3T0|PEPQ_XANOR Xaa-Pro dipeptidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pepQ PE=3 SV=2 168 450 2.0E-32
sp|Q2P6N8|PEPQ_XANOM Xaa-Pro dipeptidase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pepQ PE=3 SV=1 168 450 2.0E-32
sp|A9MYB1|PEPQ_SALPB Xaa-Pro dipeptidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pepQ PE=3 SV=1 49 451 4.0E-32
sp|Q6DAP4|PEPQ_PECAS Xaa-Pro dipeptidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pepQ PE=3 SV=1 85 447 5.0E-32
sp|C6DI64|PEPQ_PECCP Xaa-Pro dipeptidase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pepQ PE=3 SV=1 49 447 5.0E-32
sp|A3MYG3|PEPQ_ACTP2 Xaa-Pro dipeptidase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pepQ PE=3 SV=1 17 461 5.0E-32
sp|Q7CPD4|PEPQ_SALTY Xaa-Pro dipeptidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|Q9L6L4|PEPQ_SALTI Xaa-Pro dipeptidase OS=Salmonella typhi GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B4TNZ2|PEPQ_SALSV Xaa-Pro dipeptidase OS=Salmonella schwarzengrund (strain CVM19633) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5BIZ1|PEPQ_SALPK Xaa-Pro dipeptidase OS=Salmonella paratyphi A (strain AKU_12601) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|C0Q3F4|PEPQ_SALPC Xaa-Pro dipeptidase OS=Salmonella paratyphi C (strain RKS4594) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|Q5PKQ1|PEPQ_SALPA Xaa-Pro dipeptidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B4SZ86|PEPQ_SALNS Xaa-Pro dipeptidase OS=Salmonella newport (strain SL254) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B4TBS6|PEPQ_SALHS Xaa-Pro dipeptidase OS=Salmonella heidelberg (strain SL476) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5RFL5|PEPQ_SALG2 Xaa-Pro dipeptidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5QW86|PEPQ_SALEP Xaa-Pro dipeptidase OS=Salmonella enteritidis PT4 (strain P125109) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5FNX9|PEPQ_SALDC Xaa-Pro dipeptidase OS=Salmonella dublin (strain CT_02021853) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|Q57HM5|PEPQ_SALCH Xaa-Pro dipeptidase OS=Salmonella choleraesuis (strain SC-B67) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B5EZW1|PEPQ_SALA4 Xaa-Pro dipeptidase OS=Salmonella agona (strain SL483) GN=pepQ PE=3 SV=1 49 451 6.0E-32
sp|B8F8H3|PEPQ_HAEPS Xaa-Pro dipeptidase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pepQ PE=3 SV=1 17 447 2.0E-31
sp|A8ACZ6|PEPQ_CITK8 Xaa-Pro dipeptidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pepQ PE=3 SV=1 49 451 2.0E-31
sp|B2VFE3|PEPQ_ERWT9 Xaa-Pro dipeptidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pepQ PE=3 SV=1 49 447 3.0E-31
sp|A9MIX1|PEPQ_SALAR Xaa-Pro dipeptidase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pepQ PE=3 SV=1 49 451 6.0E-31
sp|B5XYG9|PEPQ_KLEP3 Xaa-Pro dipeptidase OS=Klebsiella pneumoniae (strain 342) GN=pepQ PE=3 SV=1 49 451 8.0E-31
sp|A8G8D3|PEPQ_SERP5 Xaa-Pro dipeptidase OS=Serratia proteamaculans (strain 568) GN=pepQ PE=3 SV=1 32 447 8.0E-31
sp|B5YY94|PEPQ_ECO5E Xaa-Pro dipeptidase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pepQ PE=3 SV=1 49 451 1.0E-30
sp|Q8X8I1|PEPQ_ECO57 Xaa-Pro dipeptidase OS=Escherichia coli O157:H7 GN=pepQ PE=3 SV=1 49 451 1.0E-30
sp|B7LTY8|PEPQ_ESCF3 Xaa-Pro dipeptidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|A6TGM5|PEPQ_KLEP7 Xaa-Pro dipeptidase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|Q83PG0|PEPQ_SHIFL Xaa-Pro dipeptidase OS=Shigella flexneri GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|B7NFE8|PEPQ_ECOLU Xaa-Pro dipeptidase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|P21165|PEPQ_ECOLI Xaa-Pro dipeptidase OS=Escherichia coli (strain K12) GN=pepQ PE=1 SV=2 49 451 2.0E-30
sp|B1IW60|PEPQ_ECOLC Xaa-Pro dipeptidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|A8A6V2|PEPQ_ECOHS Xaa-Pro dipeptidase OS=Escherichia coli O9:H4 (strain HS) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|B1XAK9|PEPQ_ECODH Xaa-Pro dipeptidase OS=Escherichia coli (strain K12 / DH10B) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|C5A021|PEPQ_ECOBW Xaa-Pro dipeptidase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|B7L9A5|PEPQ_ECO55 Xaa-Pro dipeptidase OS=Escherichia coli (strain 55989 / EAEC) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|A7ZU52|PEPQ_ECO24 Xaa-Pro dipeptidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|Q0SZ37|PEPQ_SHIF8 Xaa-Pro dipeptidase OS=Shigella flexneri serotype 5b (strain 8401) GN=pepQ PE=3 SV=1 49 451 2.0E-30
sp|Q32A22|PEPQ_SHIDS Xaa-Pro dipeptidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pepQ PE=3 SV=1 49 451 3.0E-30
sp|Q3YVC0|PEPQ_SHISS Xaa-Pro dipeptidase OS=Shigella sonnei (strain Ss046) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B7N2F3|PEPQ_ECO81 Xaa-Pro dipeptidase OS=Escherichia coli O81 (strain ED1a) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q1R465|PEPQ_ECOUT Xaa-Pro dipeptidase OS=Escherichia coli (strain UTI89 / UPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B1LM33|PEPQ_ECOSM Xaa-Pro dipeptidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q8FBI1|PEPQ_ECOL6 Xaa-Pro dipeptidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q0TAK9|PEPQ_ECOL5 Xaa-Pro dipeptidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|A1AI34|PEPQ_ECOK1 Xaa-Pro dipeptidase OS=Escherichia coli O1:K1 / APEC GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B7MHD2|PEPQ_ECO45 Xaa-Pro dipeptidase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|B7UNH5|PEPQ_ECO27 Xaa-Pro dipeptidase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pepQ PE=3 SV=1 49 451 4.0E-30
sp|Q7MZ93|PEPQ_PHOLL Xaa-Pro dipeptidase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pepQ PE=3 SV=1 49 453 5.0E-30
sp|B7NV19|PEPQ_ECO7I Xaa-Pro dipeptidase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pepQ PE=3 SV=1 49 451 5.0E-30
sp|B6I4I7|PEPQ_ECOSE Xaa-Pro dipeptidase OS=Escherichia coli (strain SE11) GN=pepQ PE=3 SV=1 49 451 5.0E-30
sp|B7M650|PEPQ_ECO8A Xaa-Pro dipeptidase OS=Escherichia coli O8 (strain IAI1) GN=pepQ PE=3 SV=1 49 451 5.0E-30
sp|B3GZT0|PEPQ_ACTP7 Xaa-Pro dipeptidase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pepQ PE=3 SV=1 17 461 6.0E-30
sp|Q31UE2|PEPQ_SHIBS Xaa-Pro dipeptidase OS=Shigella boydii serotype 4 (strain Sb227) GN=pepQ PE=3 SV=1 49 451 1.0E-29
sp|B2TVJ6|PEPQ_SHIB3 Xaa-Pro dipeptidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pepQ PE=3 SV=1 49 451 1.0E-29
sp|A1JIG5|PEPQ_YERE8 Xaa-Pro dipeptidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pepQ PE=3 SV=1 17 451 8.0E-28
sp|A4TR26|PEPQ_YERPP Xaa-Pro dipeptidase OS=Yersinia pestis (strain Pestoides F) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|Q1CN98|PEPQ_YERPN Xaa-Pro dipeptidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|A9R755|PEPQ_YERPG Xaa-Pro dipeptidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|Q0WAP4|PEPQ_YERPE Xaa-Pro dipeptidase OS=Yersinia pestis GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|Q1C2C5|PEPQ_YERPA Xaa-Pro dipeptidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pepQ PE=3 SV=1 17 451 9.0E-28
sp|B1JP62|PEPQ_YERPY Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|Q66FR7|PEPQ_YERPS Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|B2K0Z7|PEPQ_YERPB Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|A7FDF3|PEPQ_YERP3 Xaa-Pro dipeptidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pepQ PE=3 SV=1 17 451 1.0E-27
sp|A4WFX3|PEPQ_ENT38 Xaa-Pro dipeptidase OS=Enterobacter sp. (strain 638) GN=pepQ PE=3 SV=1 131 447 2.0E-27
sp|Q2NWT2|PEPQ_SODGM Xaa-Pro dipeptidase OS=Sodalis glossinidius (strain morsitans) GN=pepQ PE=3 SV=1 150 451 2.0E-27
sp|Q5QXH5|PEPQ1_IDILO Xaa-Pro dipeptidase 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pepQ1 PE=3 SV=1 172 447 4.0E-27
sp|Q2S6U2|PEPQ_HAHCH Xaa-Pro dipeptidase OS=Hahella chejuensis (strain KCTC 2396) GN=pepQ PE=3 SV=1 158 447 5.0E-24
sp|Q8NW55|Y1651_STAAW Uncharacterized peptidase MW1651 OS=Staphylococcus aureus (strain MW2) GN=MW1651 PE=3 SV=1 60 447 6.0E-24
sp|Q99TF5|Y1708_STAAM Uncharacterized peptidase SAV1708 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1708 PE=3 SV=2 60 447 7.0E-24
sp|Q6G8L9|Y1635_STAAS Uncharacterized peptidase SAS1635 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1635 PE=3 SV=1 60 447 7.0E-24
sp|Q7A552|Y1530_STAAN Uncharacterized peptidase SA1530 OS=Staphylococcus aureus (strain N315) GN=SA1530 PE=1 SV=2 60 447 7.0E-24
sp|P81535|PEPQ_PYRFU Xaa-Pro dipeptidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pepQ PE=1 SV=1 60 452 1.0E-23
sp|Q2YTD2|Y1567_STAAB Uncharacterized peptidase SAB1567 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1567 PE=3 SV=2 60 447 1.0E-23
sp|Q6GFZ9|Y1786_STAAR Uncharacterized peptidase SAR1786 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1786 PE=3 SV=1 60 447 3.0E-23
sp|Q2FXL9|Y1816_STAA8 Uncharacterized peptidase SAOUHSC_01816 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01816 PE=3 SV=1 60 447 2.0E-22
sp|Q5HF67|Y1756_STAAC Uncharacterized peptidase SACOL1756 OS=Staphylococcus aureus (strain COL) GN=SACOL1756 PE=3 SV=1 60 447 2.0E-22
sp|Q2FG30|Y1654_STAA3 Uncharacterized peptidase SAUSA300_1654 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1654 PE=3 SV=1 60 447 2.0E-22
sp|Q8CNW9|Y1383_STAES Uncharacterized peptidase SE_1383 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1383 PE=3 SV=2 156 447 1.0E-21
sp|Q5HNJ7|Y1271_STAEQ Uncharacterized peptidase SERP1271 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1271 PE=3 SV=1 156 447 1.0E-21
sp|Q49YD7|Y1059_STAS1 Uncharacterized peptidase SSP1059 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1059 PE=3 SV=1 82 447 6.0E-21
sp|O58885|PEPQ_PYRHO Xaa-Pro dipeptidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pepQ PE=1 SV=1 172 452 1.0E-20
sp|Q4L749|Y1217_STAHJ Uncharacterized peptidase SH1217 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1217 PE=3 SV=1 164 447 4.0E-19
sp|Q58216|Y806_METJA Uncharacterized peptidase MJ0806 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0806 PE=3 SV=1 150 449 2.0E-15
sp|O31689|YKVY_BACSU Putative dipeptidase YkvY OS=Bacillus subtilis (strain 168) GN=ykvY PE=3 SV=1 165 452 5.0E-15
sp|P54518|YQHT_BACSU Uncharacterized peptidase YqhT OS=Bacillus subtilis (strain 168) GN=yqhT PE=3 SV=1 126 452 4.0E-14
sp|B2AW39|AMPP2_PODAN Probable Xaa-Pro aminopeptidase PODANS_7_5850 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_7_5850 PE=3 SV=1 381 456 2.0E-12
sp|O25681|AMPEP_HELPY Aminopeptidase HP_1037 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_1037 PE=1 SV=1 170 446 7.0E-12
sp|P76524|YPDF_ECOLI Aminopeptidase YpdF OS=Escherichia coli (strain K12) GN=ypdF PE=1 SV=1 155 446 4.0E-11
sp|P47566|AMPP_MYCGE Putative Xaa-Pro aminopeptidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pepP PE=3 SV=1 153 438 7.0E-10
sp|Q2HA12|AMPP2_CHAGB Probable Xaa-Pro aminopeptidase CHGG_02942 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_02942 PE=3 SV=1 381 451 1.0E-09
sp|P46545|PEPQ_LACDL Xaa-Pro dipeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pepQ PE=3 SV=1 155 452 2.0E-09
sp|Q9S6S1|PEPQ_LACDE Xaa-Pro dipeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pepQ PE=1 SV=1 155 452 2.0E-09
sp|P75313|AMPP_MYCPN Putative Xaa-Pro aminopeptidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pepP PE=3 SV=1 174 438 8.0E-09
sp|Q9UUD8|YOD1_SCHPO Uncharacterized peptidase C18A7.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.01 PE=3 SV=1 154 397 3.0E-08
sp|O84913|PEPQ_LACHE Xaa-Pro dipeptidase OS=Lactobacillus helveticus GN=pepQ PE=3 SV=1 157 452 4.0E-06
sp|P9WHS7|PEPE_MYCTU Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pepE PE=1 SV=1 147 452 9.0E-06
sp|P9WHS6|PEPE_MYCTO Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pepE PE=3 SV=1 147 452 9.0E-06
sp|P65811|PEPE_MYCBO Probable dipeptidase PepE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pepE PE=3 SV=1 147 452 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030145 manganese ion binding Yes
GO:0070006 metalloaminopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0008235 metalloexopeptidase activity No
GO:0005488 binding No
GO:0008237 metallopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0004177 aminopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008238 exopeptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6975
MTDFETALKAKYPAKAHARRIVELLRDTIPDLGGVLYLEGRATRMQEDNDSPEPFRQRRHFYYLTGCNLADCRFA
YDIAADHSVLFIPPVDPDDVLWSGLPVSAEEALGRYDVDEVCYTTDVNATLARLAGQQKTAKGTAFAMAGHVSDS
VTFLEFDATDVTALKSAIDRARVVKDAHEVAMMRKANHISGLAHAAVVRRARHAELERELEAVFLERCVALGARE
MAYHPILAAGRAAATLHYVDNDARLGGKLNLLIDAGAEWDNYASDITRTFPLSGSFTKESRAIYDIVLNMQTECI
GLVKAGALWDDIHLHAHKVAIDGLLSLGLLKGDAREILEARTSAAFFPHGLGHYLGMDTHDVGGNPDRNDKDVLF
RYLRLRGQIPAGSVVTVEPGIYFCEFIIKPYLDHPVHGQYIDRAVLDRYWDVGGVRIEDNVLVTAGGCENLTTAI
KEPGEVEALVSQG
Coding >Ophio5|6975
ATGACCGACTTCGAGACGGCCCTCAAGGCCAAGTATCCGGCCAAGGCGCACGCGCGCCGCATCGTCGAGTTGCTG
CGCGACACCATTCCCGATCTCGGCGGCGTTCTCTATCTCGAGGGCCGCGCGACCCGGATGCAGGAGGACAATGAC
TCACCGGAGCCTTTCCGCCAGCGTCGACACTTCTACTACCTCACCGGCTGCAACCTCGCCGACTGCCGCTTCGCC
TACGACATCGCCGCCGACCACTCCGTCCTCTTCATCCCACCTGTCGACCCGGACGATGTGCTCTGGTCCGGCCTG
CCGGTCAGTGCCGAAGAGGCCCTCGGCCGCTACGACGTCGACGAGGTGTGTTACACCACCGACGTCAACGCCACG
CTCGCCCGTCTGGCCGGGCAGCAGAAGACAGCGAAGGGAACGGCCTTTGCCATGGCCGGCCACGTTTCCGACAGC
GTCACCTTTCTCGAGTTCGACGCGACCGACGTGACGGCCCTCAAGTCGGCCATTGATCGCGCCCGCGTCGTCAAG
GACGCTCACGAGGTCGCCATGATGCGCAAGGCAAACCACATATCCGGTCTGGCCCACGCTGCCGTCGTCCGTCGC
GCACGCCATGCCGAGCTTGAGCGTGAGCTCGAGGCTGTCTTCCTCGAGCGCTGCGTCGCCCTCGGTGCTCGCGAG
ATGGCCTACCACCCGATTCTCGCTGCCGGCCGCGCCGCTGCTACGCTGCACTACGTCGACAACGATGCTCGCCTC
GGCGGCAAGCTGAACTTGCTGATCGACGCCGGCGCCGAGTGGGACAACTATGCTTCCGACATTACGAGAACCTTT
CCCCTGTCCGGCTCCTTTACCAAAGAATCGCGCGCCATTTACGACATTGTGCTGAACATGCAGACCGAGTGCATC
GGCCTCGTCAAGGCCGGCGCGCTGTGGGATGATATTCACCTGCACGCCCATAAGGTGGCCATCGACGGTCTGCTA
TCGCTCGGCCTCCTCAAGGGCGATGCTCGTGAGATTCTCGAGGCCCGAACCAGCGCCGCCTTCTTCCCCCACGGC
CTGGGCCATTACCTCGGCATGGACACCCACGACGTCGGAGGCAATCCCGACCGCAATGACAAGGACGTGCTCTTC
CGCTACCTGCGACTCCGCGGCCAAATCCCCGCGGGTAGCGTCGTCACTGTCGAGCCAGGGATATATTTTTGCGAA
TTCATCATAAAGCCATATCTTGACCACCCTGTCCACGGGCAGTACATCGACCGCGCCGTCTTGGACAGGTATTGG
GACGTCGGCGGTGTTCGCATCGAGGACAATGTCCTCGTCACCGCCGGCGGCTGCGAGAATCTGACGACGGCGATC
AAGGAGCCCGGTGAGGTTGAGGCTCTCGTTTCTCAAGGC
Transcript >Ophio5|6975
ATGACCGACTTCGAGACGGCCCTCAAGGCCAAGTATCCGGCCAAGGCGCACGCGCGCCGCATCGTCGAGTTGCTG
CGCGACACCATTCCCGATCTCGGCGGCGTTCTCTATCTCGAGGGCCGCGCGACCCGGATGCAGGAGGACAATGAC
TCACCGGAGCCTTTCCGCCAGCGTCGACACTTCTACTACCTCACCGGCTGCAACCTCGCCGACTGCCGCTTCGCC
TACGACATCGCCGCCGACCACTCCGTCCTCTTCATCCCACCTGTCGACCCGGACGATGTGCTCTGGTCCGGCCTG
CCGGTCAGTGCCGAAGAGGCCCTCGGCCGCTACGACGTCGACGAGGTGTGTTACACCACCGACGTCAACGCCACG
CTCGCCCGTCTGGCCGGGCAGCAGAAGACAGCGAAGGGAACGGCCTTTGCCATGGCCGGCCACGTTTCCGACAGC
GTCACCTTTCTCGAGTTCGACGCGACCGACGTGACGGCCCTCAAGTCGGCCATTGATCGCGCCCGCGTCGTCAAG
GACGCTCACGAGGTCGCCATGATGCGCAAGGCAAACCACATATCCGGTCTGGCCCACGCTGCCGTCGTCCGTCGC
GCACGCCATGCCGAGCTTGAGCGTGAGCTCGAGGCTGTCTTCCTCGAGCGCTGCGTCGCCCTCGGTGCTCGCGAG
ATGGCCTACCACCCGATTCTCGCTGCCGGCCGCGCCGCTGCTACGCTGCACTACGTCGACAACGATGCTCGCCTC
GGCGGCAAGCTGAACTTGCTGATCGACGCCGGCGCCGAGTGGGACAACTATGCTTCCGACATTACGAGAACCTTT
CCCCTGTCCGGCTCCTTTACCAAAGAATCGCGCGCCATTTACGACATTGTGCTGAACATGCAGACCGAGTGCATC
GGCCTCGTCAAGGCCGGCGCGCTGTGGGATGATATTCACCTGCACGCCCATAAGGTGGCCATCGACGGTCTGCTA
TCGCTCGGCCTCCTCAAGGGCGATGCTCGTGAGATTCTCGAGGCCCGAACCAGCGCCGCCTTCTTCCCCCACGGC
CTGGGCCATTACCTCGGCATGGACACCCACGACGTCGGAGGCAATCCCGACCGCAATGACAAGGACGTGCTCTTC
CGCTACCTGCGACTCCGCGGCCAAATCCCCGCGGGTAGCGTCGTCACTGTCGAGCCAGGGATATATTTTTGCGAA
TTCATCATAAAGCCATATCTTGACCACCCTGTCCACGGGCAGTACATCGACCGCGCCGTCTTGGACAGGTATTGG
GACGTCGGCGGTGTTCGCATCGAGGACAATGTCCTCGTCACCGCCGGCGGCTGCGAGAATCTGACGACGGCGATC
AAGGAGCCCGGTGAGGTTGAGGCTCTCGTTTCTCAAGGCTGA
Gene >Ophio5|6975
ATGACCGACTTCGAGACGGCCCTCAAGGCCAAGTATCCGGCCAAGGCGCACGCGCGCCGCATCGTCGAGTTGCTG
CGCGACACCATTCCCGATCTCGGCGGCGTTCTCTATCTCGAGGGCCGCGCGACCCGGATGCAGGAGGACAATGAC
TCACCGGAGCCTTTCCGGTAAGCCTACTTGGAGCCATCTTCACCCTTACTGAAGCTGGAGCAGCCAGCGTCGACA
CTTCTACTACCTCACCGGCTGCAACCTCGCCGACTGCCGCTTCGCCTACGACATCGCCGCCGACCACTCCGTCCT
CTTCATCCCACCTGTCGACCCGGACGATGTGCTCTGGTCCGGCCTGCCGGTCAGTGCCGAAGAGGCCCTCGGCCG
CTACGACGTCGACGAGGTGTGTTACACCACCGACGTCAACGCCACGCTCGCCCGTCTGGCCGGGCAGCAGAAGAC
AGCGAAGGGAACGGCCTTTGCCATGGCCGGCCACGTTTCCGACAGCGTCACCTTTCTCGAGTTCGACGCGACCGA
CGTGACGGCCCTCAAGTCGGCCATTGATCGCGCCCGCGTCGTCAAGGACGCTCACGAGGTCGCCATGATGCGCAA
GGCAAACCACATATCCGGTCTGGCCCACGCTGCCGTCGTCCGTCGCGCACGCCATGCCGAGCTTGAGCGTGAGCT
CGAGGCTGTCTTCCTCGAGCGCTGCGTCGCCCTCGGTGCTCGCGAGATGGCCTACCACCCGATTCTCGCTGCCGG
CCGCGCCGCTGCTACGCTGCACTACGTCGACAACGATGCTCGCCTCGGCGGCAAGCTGAACTTGCTGATCGACGC
CGGCGCCGAGTGGGACAACTATGCTTCCGACATTGTCAGACTCAAGACGCCCCTCCGACTGGCTTGTTTTTTTTT
TGGCATGGCTGACCGACTTAGACGAGAACCTTTCCCCTGTCCGGCTCCTTTACCAAAGAATCGCGCGCCATTTAC
GACATTGTGCTGAACATGCAGACCGAGTGCATCGGCCTCGTCAAGGCCGGCGCGCTGTGGGATGATATTCACCTG
CACGCCCATAAGGTGGCCATCGACGGTCTGCTATCGCTCGGCCTCCTCAAGGGCGATGCTCGTGAGATTCTCGAG
GCCCGAACCAGCGCCGCCTTCTTCCCCCACGGCCTGGGCCATTACCTCGGCATGGACACCCACGACGTCGGAGGC
AATCCCGACCGCAATGACAAGGACGTGCTCTTCCGCTACCTGCGACTCCGCGGCCAAATCCCCGCGGGTAGCGTC
GTCACTGTCGAGCCAGGGGTGCGCTGAGACCTGTGTCTGTTCTTCTCTTGCTTTTATTCTTCCTGTGCTAAAAGG
CCGTCTGCAGATATATTTTTGCGAATTCATCATAAAGCCATATCTTGACCACCCTGTCCACGGGCAGTACATCGA
CCGCGCCGTCTTGGACAGGTATTGGGACGTCGGCGGTGTTCGGTGAGTTGGGCTGACAACTCTGTTTGCCATTTG
TCGCTGACTCTGTGCGTCTACATCTACAGCATCGAGGACAATGTCCTCGTCACCGCCGGCGGCTGCGAGAATCTG
ACGACGGCGATCAAGGAGCCCGGTGAGGTTGAGGCTCTCGTTTCTCAAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail