Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6965
Gene name
Locationscaffold_639:407..2862
Strand-
Gene length (bp)2455
Transcript length (bp)2343
Coding sequence length (bp)2340
Protein length (aa) 780

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01432 Peptidase_M3 Peptidase family M3 7.5E-120 290 777

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25375|PRTD_YEAST Saccharolysin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRD1 PE=1 SV=1 51 778 4.0E-108
sp|Q1JPJ8|THOP1_BOVIN Thimet oligopeptidase OS=Bos taurus GN=THOP1 PE=2 SV=3 67 778 1.0E-100
sp|Q8C1A5|THOP1_MOUSE Thimet oligopeptidase OS=Mus musculus GN=Thop1 PE=1 SV=1 67 778 1.0E-98
sp|P24155|THOP1_RAT Thimet oligopeptidase OS=Rattus norvegicus GN=Thop1 PE=1 SV=4 67 778 3.0E-98
sp|P52888|THOP1_HUMAN Thimet oligopeptidase OS=Homo sapiens GN=THOP1 PE=1 SV=2 67 778 6.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25375|PRTD_YEAST Saccharolysin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRD1 PE=1 SV=1 51 778 4.0E-108
sp|Q1JPJ8|THOP1_BOVIN Thimet oligopeptidase OS=Bos taurus GN=THOP1 PE=2 SV=3 67 778 1.0E-100
sp|Q8C1A5|THOP1_MOUSE Thimet oligopeptidase OS=Mus musculus GN=Thop1 PE=1 SV=1 67 778 1.0E-98
sp|P24155|THOP1_RAT Thimet oligopeptidase OS=Rattus norvegicus GN=Thop1 PE=1 SV=4 67 778 3.0E-98
sp|P52888|THOP1_HUMAN Thimet oligopeptidase OS=Homo sapiens GN=THOP1 PE=1 SV=2 67 778 6.0E-97
sp|P47788|THOP1_PIG Thimet oligopeptidase OS=Sus scrofa GN=THOP1 PE=2 SV=2 67 778 4.0E-93
sp|Q91YP2|NEUL_MOUSE Neurolysin, mitochondrial OS=Mus musculus GN=Nln PE=1 SV=1 69 778 2.0E-89
sp|P42676|NEUL_RAT Neurolysin, mitochondrial OS=Rattus norvegicus GN=Nln PE=1 SV=1 69 778 1.0E-88
sp|Q02038|NEUL_PIG Neurolysin, mitochondrial OS=Sus scrofa GN=NLN PE=1 SV=1 69 778 3.0E-87
sp|P42675|NEUL_RABIT Neurolysin, mitochondrial OS=Oryctolagus cuniculus GN=NLN PE=1 SV=1 69 778 6.0E-87
sp|Q5R9V6|NEUL_PONAB Neurolysin, mitochondrial OS=Pongo abelii GN=NLN PE=2 SV=1 69 778 8.0E-86
sp|A2VDQ5|NEUL_BOVIN Neurolysin, mitochondrial OS=Bos taurus GN=NLN PE=2 SV=1 69 778 1.0E-85
sp|Q9BYT8|NEUL_HUMAN Neurolysin, mitochondrial OS=Homo sapiens GN=NLN PE=1 SV=1 69 778 8.0E-85
sp|Q54DD2|THOPL_DICDI Thimet-like oligopeptidase OS=Dictyostelium discoideum GN=DDB_G0292362 PE=3 SV=1 64 778 6.0E-74
sp|P27237|OPDA_SALTY Oligopeptidase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prlC PE=1 SV=1 54 778 2.0E-65
sp|P27298|OPDA_ECOLI Oligopeptidase A OS=Escherichia coli (strain K12) GN=prlC PE=3 SV=3 60 778 4.0E-63
sp|P44573|OPDA_HAEIN Oligopeptidase A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prlC PE=3 SV=1 42 778 3.0E-60
sp|F4HTQ1|MPRO1_ARATH Probable thimet oligopeptidase OS=Arabidopsis thaliana GN=At1g67690 PE=3 SV=1 88 772 7.0E-55
sp|F4KDA5|MIPEP_ARATH Probable mitochondrial intermediate peptidase, mitochondrial OS=Arabidopsis thaliana GN=MIP PE=3 SV=1 278 766 3.0E-52
sp|Q949P2|COPDA_ARATH Probable cytosolic oligopeptidase A OS=Arabidopsis thaliana GN=CYOP PE=1 SV=1 60 778 5.0E-49
sp|Q94AM1|OOPDA_ARATH Organellar oligopeptidase A, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OOP PE=1 SV=1 133 778 3.0E-44
sp|Q99797|MIPEP_HUMAN Mitochondrial intermediate peptidase OS=Homo sapiens GN=MIPEP PE=1 SV=2 325 776 6.0E-44
sp|Q5RF14|MIPEP_PONAB Mitochondrial intermediate peptidase OS=Pongo abelii GN=MIPEP PE=2 SV=1 325 776 2.0E-43
sp|A6H611|MIPEP_MOUSE Mitochondrial intermediate peptidase OS=Mus musculus GN=Mipep PE=1 SV=1 325 776 4.0E-42
sp|P24171|DCP_ECOLI Peptidyl-dipeptidase dcp OS=Escherichia coli (strain K12) GN=dcp PE=1 SV=4 79 778 7.0E-42
sp|Q01992|MIPEP_RAT Mitochondrial intermediate peptidase OS=Rattus norvegicus GN=Mipep PE=1 SV=1 344 776 2.0E-38
sp|A7TSL2|PMIP_VANPO Mitochondrial intermediate peptidase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=OCT1 PE=3 SV=1 289 754 2.0E-37
sp|Q7SDD5|PMIP_NEUCR Mitochondrial intermediate peptidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=oct-1 PE=3 SV=1 260 759 2.0E-37
sp|Q59RK9|PMIP_CANAL Mitochondrial intermediate peptidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OCT1 PE=3 SV=1 288 764 3.0E-37
sp|Q6FW88|PMIP_CANGA Mitochondrial intermediate peptidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=OCT1 PE=3 SV=1 290 751 3.0E-37
sp|Q6CVF7|PMIP_KLULA Mitochondrial intermediate peptidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=OCT1 PE=3 SV=1 288 763 9.0E-36
sp|P0CQ18|PMIP1_CRYNJ Mitochondrial intermediate peptidase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=OCT1 PE=3 SV=1 287 764 1.0E-35
sp|P0CQ19|PMIP1_CRYNB Mitochondrial intermediate peptidase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=OCT1 PE=3 SV=1 287 764 1.0E-35
sp|A6ZZI7|PMIP_YEAS7 Mitochondrial intermediate peptidase OS=Saccharomyces cerevisiae (strain YJM789) GN=OCT1 PE=3 SV=1 287 763 3.0E-35
sp|P35999|PMIP_YEAST Mitochondrial intermediate peptidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCT1 PE=1 SV=2 287 763 3.0E-35
sp|P27236|DCP_SALTY Peptidyl-dipeptidase dcp OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dcp PE=1 SV=1 317 778 8.0E-34
sp|Q6CHD6|PMIP_YARLI Mitochondrial intermediate peptidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=OCT1 PE=3 SV=1 296 759 2.0E-33
sp|Q1E8M9|PMIP_COCIM Mitochondrial intermediate peptidase OS=Coccidioides immitis (strain RS) GN=OCT1 PE=3 SV=1 296 767 3.0E-33
sp|Q0CI79|PMIP_ASPTN Mitochondrial intermediate peptidase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=oct1 PE=3 SV=2 296 764 7.0E-33
sp|Q2UN31|PMIP_ASPOR Mitochondrial intermediate peptidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=oct1 PE=3 SV=1 296 764 1.0E-32
sp|Q753X4|PMIP_ASHGO Mitochondrial intermediate peptidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=OCT1 PE=3 SV=1 288 763 1.0E-32
sp|B0CRC2|PMIP_LACBS Mitochondrial intermediate peptidase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=OCT1 PE=3 SV=1 286 763 1.0E-32
sp|A1CTP5|PMIP_ASPCL Mitochondrial intermediate peptidase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=oct1 PE=3 SV=1 296 771 3.0E-32
sp|Q0TXL7|PMIP_PHANO Mitochondrial intermediate peptidase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=OCT1 PE=3 SV=2 276 754 2.0E-31
sp|P0CQ20|PMIP2_CRYNJ Mitochondrial intermediate peptidase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=OCT2 PE=3 SV=1 137 764 2.0E-31
sp|P0CQ21|PMIP2_CRYNB Mitochondrial intermediate peptidase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=OCT2 PE=3 SV=1 137 764 2.0E-31
sp|A8N2T3|PMIP_COPC7 Mitochondrial intermediate peptidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=OCT1 PE=3 SV=2 287 763 3.0E-31
sp|Q6VMB4|PMIP_LEUGO Mitochondrial intermediate peptidase OS=Leucoagaricus gongylophorus GN=OCT1 PE=3 SV=1 286 763 3.0E-31
sp|A1DMR2|PMIP_NEOFI Mitochondrial intermediate peptidase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=oct1 PE=3 SV=1 296 771 4.0E-31
sp|A2QWM4|PMIP_ASPNC Mitochondrial intermediate peptidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=oct1 PE=3 SV=1 296 764 2.0E-30
sp|Q6Y5M5|PMIP_PLEDJ Mitochondrial intermediate peptidase OS=Pleurotus djamor GN=OCT1 PE=3 SV=1 286 763 6.0E-30
sp|Q4PBS8|PMIP_USTMA Mitochondrial intermediate peptidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=OCT1 PE=3 SV=3 280 777 1.0E-29
sp|Q4WMU9|PMIP_ASPFU Mitochondrial intermediate peptidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=oct1 PE=3 SV=1 296 771 3.0E-29
sp|A5DI46|PMIP_PICGU Mitochondrial intermediate peptidase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=OCT1 PE=3 SV=2 249 766 5.0E-29
sp|B0Y7Q2|PMIP_ASPFC Mitochondrial intermediate peptidase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=oct1 PE=3 SV=1 296 771 6.0E-29
sp|Q6Y5M7|PMIP_COPSC Mitochondrial intermediate peptidase OS=Coprinopsis scobicola GN=OCT1 PE=3 SV=1 286 763 1.0E-28
sp|A8QB25|PMIP_MALGO Mitochondrial intermediate peptidase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=OCT1 PE=3 SV=2 288 763 1.0E-28
sp|Q2HFL8|PMIP_CHAGB Mitochondrial intermediate peptidase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=OCT1 PE=3 SV=1 345 763 6.0E-28
sp|A3LUT4|PMIP_PICST Mitochondrial intermediate peptidase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=OCT1 PE=3 SV=2 220 763 7.0E-28
sp|A4RF25|PMIP_MAGO7 Mitochondrial intermediate peptidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=OCT1 PE=3 SV=1 276 763 8.0E-28
sp|Q6Y5M6|PMIP_COPDI Mitochondrial intermediate peptidase OS=Coprinellus disseminatus GN=OCT1 PE=3 SV=1 287 763 1.0E-27
sp|Q6BJ61|PMIP_DEBHA Mitochondrial intermediate peptidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=OCT1 PE=3 SV=2 217 764 4.0E-27
sp|A5E4V6|PMIP_LODEL Mitochondrial intermediate peptidase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=OCT1 PE=3 SV=1 288 763 5.0E-27
sp|P37932|PMIP_SCHCO Mitochondrial intermediate peptidase OS=Schizophyllum commune GN=OCT1 PE=3 SV=2 286 763 5.0E-26
sp|Q10415|PMIP_SCHPO Mitochondrial intermediate peptidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oct1 PE=3 SV=1 329 763 8.0E-26
sp|A7E7L8|PMIP_SCLS1 Mitochondrial intermediate peptidase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=oct1 PE=3 SV=2 296 770 2.0E-24
sp|A6SHZ5|PMIP_BOTFB Mitochondrial intermediate peptidase (Fragment) OS=Botryotinia fuckeliana (strain B05.10) GN=oct1 PE=3 SV=2 296 770 6.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0043170 macromolecule metabolic process No
GO:0016787 hydrolase activity No
GO:0019538 protein metabolic process No
GO:0008237 metallopeptidase activity No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0004175 endopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6965
MLPLRLLLALAGILVVQARIGFGEPRSQPPFAPSPTDVGLKSGPVQRVQQTPDFKQPPQPPYVFKATAESIRADG
RQWMKEMKAKYDDVVANVQPENATFANVLEPILVRDNSSAPSEHLLGFYLTVSADAAIRAASSEFRQLLSSFQLE
MHSRKDYAALVEAVHDSARNQSLEAEQLRILRSHHQQLLLRGLGRPNNQRVVEAGTKKLHNLASIGNVSNNATEM
EKELKDLSLKANRNLVENNGSIWFTREELEGVPKRELKWDELEKGSGENEGKLRLTFEPSHAHSIMTHAVNETTR
LEYYIAFNNKDDINAPLFHRLAVLRDAKARQAGHSNHASMRTAGMMAKTPDAVKDFLGDLRNRLQDEGARELAPI
LENKKRHYEKRNASFDGNLFAWDIGFYSHGDRGGEDEEPVKDEVEMDAVETAVSVSDYFPMDTTMERMLGLVGKL
FGLVFVELQAEDLARLSATGKAEDLAWHQDVTTYAVWDDEEAGHGFIGYLYLDLYLRDHKPGGAFNFNLVPGFSR
SDGSRNYPSTVVVSSLSKPPSPRPMLLSHSEMVMVFHELGHAMHDLLSRTKYACLHGTQVAVDFVEAPSQMLENW
TWLPGVIKSLSRHWQTDESMPDSTVDGLVASRKSMKAHNTLGMLHYSLFDMEMHSPKTHEDARKLDLSKLWNGLR
RNVTGIKGPEELGLGSDWGHKYASLGHLVGGYDAAYYSYLWSLVYSADMYHSVFEKDPMNGDEGRRYRRTVLEKG
GSMDEMEMLEEFLGRKPNSEAFYKQLGLAE
Coding >Ophio5|6965
ATGCTGCCTCTTCGCCTCCTCCTCGCCCTTGCGGGGATCCTGGTAGTCCAGGCCCGGATCGGATTCGGGGAGCCG
CGTTCCCAGCCCCCTTTTGCCCCTTCGCCAACTGATGTCGGCCTGAAGAGCGGCCCAGTGCAGCGGGTCCAACAG
ACGCCCGATTTCAAGCAGCCGCCGCAACCGCCATATGTCTTCAAAGCGACGGCCGAGTCCATCCGTGCCGATGGG
CGACAGTGGATGAAGGAAATGAAGGCCAAGTATGATGATGTCGTGGCAAACGTGCAGCCTGAAAATGCCACGTTT
GCCAACGTCTTGGAACCCATCCTCGTTCGTGACAACAGCTCAGCTCCGTCGGAACACCTCCTCGGCTTCTATCTT
ACTGTCTCGGCCGACGCCGCCATTCGTGCCGCCTCGAGTGAATTCCGGCAGTTGCTCAGCAGCTTCCAGCTTGAA
ATGCACTCGCGCAAGGATTACGCTGCGCTCGTCGAAGCCGTCCACGACTCGGCCAGGAACCAGAGTCTCGAAGCT
GAGCAGCTCCGCATCCTCCGCTCCCATCACCAACAGCTCCTCCTCAGAGGCCTTGGCCGGCCCAACAACCAGCGT
GTCGTCGAGGCCGGCACCAAGAAGCTTCACAACCTGGCCTCGATTGGCAACGTAAGCAACAACGCCACAGAGATG
GAGAAGGAGCTTAAGGATCTCTCCCTCAAGGCCAATCGAAATCTGGTTGAGAATAATGGCAGCATTTGGTTCACT
CGGGAGGAACTCGAGGGCGTACCAAAACGCGAACTGAAATGGGATGAGCTCGAGAAGGGTTCCGGCGAGAATGAG
GGCAAGTTGAGGCTCACGTTCGAGCCCAGTCATGCCCACTCTATCATGACGCATGCCGTCAACGAGACGACGAGA
CTCGAGTACTATATTGCTTTCAACAACAAGGACGACATCAACGCACCCCTTTTTCACAGATTGGCTGTGCTTCGG
GACGCAAAAGCGCGCCAGGCAGGCCATTCCAATCATGCGAGCATGCGCACCGCCGGCATGATGGCCAAGACGCCG
GACGCGGTCAAGGACTTCCTCGGAGATCTGCGCAACCGGCTCCAGGACGAGGGCGCCCGAGAGTTGGCGCCGATT
CTCGAGAACAAGAAGCGTCATTACGAGAAGCGAAACGCCAGCTTTGACGGCAACCTCTTTGCCTGGGACATAGGC
TTTTACTCCCACGGCGACAGGGGGGGGGAGGATGAGGAGCCGGTCAAGGACGAGGTTGAAATGGATGCGGTCGAG
ACTGCAGTTTCCGTCTCGGACTACTTTCCCATGGACACCACCATGGAGCGCATGTTGGGCCTGGTTGGCAAGCTT
TTCGGCCTCGTCTTCGTCGAGCTCCAGGCCGAGGACCTGGCACGGCTGAGTGCGACTGGCAAGGCCGAGGATCTT
GCCTGGCACCAAGACGTGACCACGTACGCCGTCTGGGACGACGAGGAGGCCGGCCACGGCTTCATCGGCTACCTC
TATCTCGACCTGTACTTGCGCGATCACAAGCCCGGAGGCGCCTTCAACTTCAACTTGGTGCCCGGCTTCTCACGG
AGCGATGGCAGCCGCAACTACCCATCGACGGTGGTGGTGTCGAGCCTGAGCAAGCCCCCGTCGCCGCGGCCGATG
CTTCTCAGCCACAGTGAGATGGTGATGGTCTTCCACGAGCTCGGGCACGCCATGCACGACTTGCTGTCTCGGACG
AAATACGCCTGCCTTCACGGAACGCAGGTGGCCGTGGACTTTGTGGAAGCCCCGTCGCAGATGTTGGAGAACTGG
ACTTGGCTGCCGGGCGTCATCAAGTCTTTGTCTCGACACTGGCAGACGGACGAGTCGATGCCCGACTCCACCGTC
GACGGGCTCGTCGCCTCGAGGAAATCGATGAAGGCACATAACACGCTGGGGATGCTGCATTATTCCCTTTTCGAC
ATGGAGATGCACTCTCCCAAGACGCACGAGGACGCACGGAAGCTCGACCTGAGCAAGTTGTGGAACGGGCTGAGG
CGTAATGTCACGGGCATCAAGGGCCCCGAGGAGCTTGGTCTGGGCTCGGACTGGGGTCATAAGTACGCCAGCCTC
GGCCATCTGGTCGGGGGCTACGATGCCGCCTACTATTCCTACCTTTGGTCGCTGGTCTACTCGGCCGACATGTAC
CACTCCGTCTTTGAAAAGGACCCGATGAACGGCGACGAGGGTCGACGGTACCGGCGGACGGTGCTGGAGAAAGGC
GGGAGCATGGACGAGATGGAGATGCTGGAGGAGTTTTTGGGCAGGAAGCCCAACTCGGAGGCGTTTTACAAGCAG
CTGGGGCTGGCCGAG
Transcript >Ophio5|6965
ATGCTGCCTCTTCGCCTCCTCCTCGCCCTTGCGGGGATCCTGGTAGTCCAGGCCCGGATCGGATTCGGGGAGCCG
CGTTCCCAGCCCCCTTTTGCCCCTTCGCCAACTGATGTCGGCCTGAAGAGCGGCCCAGTGCAGCGGGTCCAACAG
ACGCCCGATTTCAAGCAGCCGCCGCAACCGCCATATGTCTTCAAAGCGACGGCCGAGTCCATCCGTGCCGATGGG
CGACAGTGGATGAAGGAAATGAAGGCCAAGTATGATGATGTCGTGGCAAACGTGCAGCCTGAAAATGCCACGTTT
GCCAACGTCTTGGAACCCATCCTCGTTCGTGACAACAGCTCAGCTCCGTCGGAACACCTCCTCGGCTTCTATCTT
ACTGTCTCGGCCGACGCCGCCATTCGTGCCGCCTCGAGTGAATTCCGGCAGTTGCTCAGCAGCTTCCAGCTTGAA
ATGCACTCGCGCAAGGATTACGCTGCGCTCGTCGAAGCCGTCCACGACTCGGCCAGGAACCAGAGTCTCGAAGCT
GAGCAGCTCCGCATCCTCCGCTCCCATCACCAACAGCTCCTCCTCAGAGGCCTTGGCCGGCCCAACAACCAGCGT
GTCGTCGAGGCCGGCACCAAGAAGCTTCACAACCTGGCCTCGATTGGCAACGTAAGCAACAACGCCACAGAGATG
GAGAAGGAGCTTAAGGATCTCTCCCTCAAGGCCAATCGAAATCTGGTTGAGAATAATGGCAGCATTTGGTTCACT
CGGGAGGAACTCGAGGGCGTACCAAAACGCGAACTGAAATGGGATGAGCTCGAGAAGGGTTCCGGCGAGAATGAG
GGCAAGTTGAGGCTCACGTTCGAGCCCAGTCATGCCCACTCTATCATGACGCATGCCGTCAACGAGACGACGAGA
CTCGAGTACTATATTGCTTTCAACAACAAGGACGACATCAACGCACCCCTTTTTCACAGATTGGCTGTGCTTCGG
GACGCAAAAGCGCGCCAGGCAGGCCATTCCAATCATGCGAGCATGCGCACCGCCGGCATGATGGCCAAGACGCCG
GACGCGGTCAAGGACTTCCTCGGAGATCTGCGCAACCGGCTCCAGGACGAGGGCGCCCGAGAGTTGGCGCCGATT
CTCGAGAACAAGAAGCGTCATTACGAGAAGCGAAACGCCAGCTTTGACGGCAACCTCTTTGCCTGGGACATAGGC
TTTTACTCCCACGGCGACAGGGGGGGGGAGGATGAGGAGCCGGTCAAGGACGAGGTTGAAATGGATGCGGTCGAG
ACTGCAGTTTCCGTCTCGGACTACTTTCCCATGGACACCACCATGGAGCGCATGTTGGGCCTGGTTGGCAAGCTT
TTCGGCCTCGTCTTCGTCGAGCTCCAGGCCGAGGACCTGGCACGGCTGAGTGCGACTGGCAAGGCCGAGGATCTT
GCCTGGCACCAAGACGTGACCACGTACGCCGTCTGGGACGACGAGGAGGCCGGCCACGGCTTCATCGGCTACCTC
TATCTCGACCTGTACTTGCGCGATCACAAGCCCGGAGGCGCCTTCAACTTCAACTTGGTGCCCGGCTTCTCACGG
AGCGATGGCAGCCGCAACTACCCATCGACGGTGGTGGTGTCGAGCCTGAGCAAGCCCCCGTCGCCGCGGCCGATG
CTTCTCAGCCACAGTGAGATGGTGATGGTCTTCCACGAGCTCGGGCACGCCATGCACGACTTGCTGTCTCGGACG
AAATACGCCTGCCTTCACGGAACGCAGGTGGCCGTGGACTTTGTGGAAGCCCCGTCGCAGATGTTGGAGAACTGG
ACTTGGCTGCCGGGCGTCATCAAGTCTTTGTCTCGACACTGGCAGACGGACGAGTCGATGCCCGACTCCACCGTC
GACGGGCTCGTCGCCTCGAGGAAATCGATGAAGGCACATAACACGCTGGGGATGCTGCATTATTCCCTTTTCGAC
ATGGAGATGCACTCTCCCAAGACGCACGAGGACGCACGGAAGCTCGACCTGAGCAAGTTGTGGAACGGGCTGAGG
CGTAATGTCACGGGCATCAAGGGCCCCGAGGAGCTTGGTCTGGGCTCGGACTGGGGTCATAAGTACGCCAGCCTC
GGCCATCTGGTCGGGGGCTACGATGCCGCCTACTATTCCTACCTTTGGTCGCTGGTCTACTCGGCCGACATGTAC
CACTCCGTCTTTGAAAAGGACCCGATGAACGGCGACGAGGGTCGACGGTACCGGCGGACGGTGCTGGAGAAAGGC
GGGAGCATGGACGAGATGGAGATGCTGGAGGAGTTTTTGGGCAGGAAGCCCAACTCGGAGGCGTTTTACAAGCAG
CTGGGGCTGGCCGAGTGA
Gene >Ophio5|6965
ATGCTGCCTCTTCGCCTCCTCCTCGCCCTTGCGGGGATCCTGGTAGTCCAGGCCCGGATCGGATTCGGGGAGCCG
CGTTCCCAGCCCCCTTTTGCCCCTTCGCCAACTGATGTCGGCCTGAAGAGCGGCCCAGTGCAGCGGGTCCAACAG
ACGCCCGATTTCAAGCAGCCGCCGCAACCGCCATATGTCTTCAAAGCGACGGCCGAGTCCATCCGTGCCGATGGG
CGACAGTGGATGAAGGAAATGAAGGCCAAGTATGATGATGTCGTGGCAAACGTGCAGCCTGAAAATGCCACGTTT
GCCAACGTCTTGGAACCCATCCTCGTTCGTGACAACAGCTCAGCTCCGTCGGAACACCTCCTCGGCTTCTATCTT
ACTGTCTCGGCCGACGCCGCCATTCGTGCCGCCTCGAGTGAATTCCGGCAGTTGCTCAGCAGCTTCCAGCTTGAA
ATGCACTCGCGCAAGGATTACGCTGCGCTCGTCGAAGCCGTCCACGACTCGGCCAGGAACCAGAGTCTCGAAGCT
GAGCAGCTCCGCATCCTCCGCTCCCATCACCAACAGCTCCTCCTCAGAGGCCTTGGCCGGCCCAACAACCAGCGT
GTCGTCGAGGCCGGCACCAAGAAGCTTCACAACCTGGCCTCGATTGGCAACGTAAGCAACAACGCCACAGAGATG
GAGAAGGAGCTTAAGGATCTCTCCCTCAAGGCCAATCGAAATCTGGTTGAGAATAATGGCAGCATTTGGTTCACT
CGGGAGGAACTCGAGGGCGTACCAAAACGCGAACTGAAATGGGATGAGCTCGAGAAGGGTTCCGGCGAGAATGAG
GGCAAGTTGAGGCTCACGTTCGAGCCCAGTCATGCCCACTCTATCATGACGCATGCCGTCAACGAGACGACGAGA
CTCGAGTACTATATTGCTTTCAACAACAAGGTGAGAGAGACTGGGACTGCCACGTCGACACTGGAGCTGACTTGG
GCAGGACGACATCAACGCACCCCTTTTTCACAGATTGGCTGTGCTTCGGGACGCAAAAGCGCGCCAGGCAGGCCA
TTCCAATCATGCGAGCATGCGCACCGCCGGCATGATGGCCAAGACGCCGGACGCGGTCAAGGACTTCCTCGGAGA
TCTGCGCAACCGGCTCCAGGACGAGGGCGCCCGAGAGTTGGCGCCGATTCTCGAGAACAAGAAGCGTCATTACGA
GAAGCGAAACGCCAGCTTTGACGGCAACCTCTTTGCCTGGGACATAGGCTTTTACTCCCACGGCGACAGGGGGGG
GGAGGATGAGGAGCCGGTCAAGGACGAGGTTGAAATGGATGCGGTCGAGACTGCAGTTTCCGTCTCGGACTACTT
TCCCATGGACACCACCATGGAGCGCATGTTGGGCCTGGTTGGCAAGCTTTTCGGCCTCGTCTTCGTCGAGCTCCA
GGCCGAGGACCTGGCACGGCTGAGTGCGACTGGCAAGGCCGAGGATCTTGCCTGGCACCAAGACGTGACCACGTA
CGCCGTCTGGGACGACGAGGAGGCCGGCCACGGCTTCATCGGCTACCTCTATCTCGACCTGTACTTGCGCGATCA
CAAGCCCGGAGGCGCCTTCAACTTCAACTTGGTGCCCGGCTTCTCACGGAGCGATGGCAGCCGCAACTACCCATC
GACGGTGGTGGTGTCGAGCCTGAGCAAGCCCCCGTCGCCGCGGCCGATGCTTCTCAGCCACAGTGAGATGGTGAT
GGTCTTCCACGAGCTCGGGCACGCCATGCACGACTTGCTGTCTCGGACGAAATACGCCTGCCTTCACGGAACGCA
GGTGGCCGTGGACTTTGTGGAAGCCCCGTCGCAGATGTTGGAGAACTGGACTTGGCTGCCGGGCGTCATCAAGTC
TTTGTCTCGACACTGGCAGACGGACGAGTCGATGCCCGACTCCACCGTCGACGGGCTCGTCGCCTCGAGGAAATC
GATGAAGGCACATAACACGCTGGGGATGCTGCATTATTCCCTTTTCGACATGGAGATGCACTCTCCCAAGACGCA
CGAGGACGCACGGAAGCTCGACCTGAGCAAGTTGTGGAACGGGCTGAGGCGTAATGTCACGGGCATCAAGGGCCC
CGAGGAGCTTGGTCTGGGCTCGTGAGTCGCTTGACGTCCCATTCTCATTACTCGTCTCGAGGCTGACCAGACGGG
ACGCGACAGGGACTGGGGTCATAAGTACGCCAGCCTCGGCCATCTGGTCGGGGGCTACGATGCCGCCTACTATTC
CTACCTTTGGTCGCTGGTCTACTCGGCCGACATGTACCACTCCGTCTTTGAAAAGGACCCGATGAACGGCGACGA
GGGTCGACGGTACCGGCGGACGGTGCTGGAGAAAGGCGGGAGCATGGACGAGATGGAGATGCTGGAGGAGTTTTT
GGGCAGGAAGCCCAACTCGGAGGCGTTTTACAAGCAGCTGGGGCTGGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail