Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|696
Gene name
Locationscaffold_119:25006..25477
Strand-
Gene length (bp)471
Transcript length (bp)366
Coding sequence length (bp)363
Protein length (aa) 121

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74394|RM39_SCHPO 54S ribosomal protein L39, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl39 PE=3 SV=1 64 119 7.0E-10
sp|Q9CQP0|RM33_MOUSE 39S ribosomal protein L33, mitochondrial OS=Mus musculus GN=Mrpl33 PE=1 SV=1 67 118 2.0E-09
sp|Q3SZ47|RM33_BOVIN 39S ribosomal protein L33, mitochondrial OS=Bos taurus GN=MRPL33 PE=1 SV=1 67 118 1.0E-08
sp|O75394|RM33_HUMAN 39S ribosomal protein L33, mitochondrial OS=Homo sapiens GN=MRPL33 PE=1 SV=1 67 118 1.0E-07
sp|Q4RGM4|RM33_TETNG 39S ribosomal protein L33, mitochondrial OS=Tetraodon nigroviridis GN=mrpl33 PE=3 SV=1 67 118 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74394|RM39_SCHPO 54S ribosomal protein L39, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl39 PE=3 SV=1 64 119 7.0E-10
sp|Q9CQP0|RM33_MOUSE 39S ribosomal protein L33, mitochondrial OS=Mus musculus GN=Mrpl33 PE=1 SV=1 67 118 2.0E-09
sp|Q3SZ47|RM33_BOVIN 39S ribosomal protein L33, mitochondrial OS=Bos taurus GN=MRPL33 PE=1 SV=1 67 118 1.0E-08
sp|O75394|RM33_HUMAN 39S ribosomal protein L33, mitochondrial OS=Homo sapiens GN=MRPL33 PE=1 SV=1 67 118 1.0E-07
sp|Q4RGM4|RM33_TETNG 39S ribosomal protein L33, mitochondrial OS=Tetraodon nigroviridis GN=mrpl33 PE=3 SV=1 67 118 4.0E-07
sp|Q2G3F0|RL33_NOVAD 50S ribosomal protein L33 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpmG PE=3 SV=1 68 119 9.0E-07
sp|Q5FNN7|RL33_GLUOX 50S ribosomal protein L33 OS=Gluconobacter oxydans (strain 621H) GN=rpmG PE=3 SV=1 68 119 1.0E-06
sp|Q5NQY1|RL33_ZYMMO 50S ribosomal protein L33 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpmG PE=3 SV=1 68 119 1.0E-06
sp|B9JVH6|RL33_AGRVS 50S ribosomal protein L33 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpmG PE=3 SV=1 68 119 2.0E-06
sp|P66216|RL33_BRUSU 50S ribosomal protein L33 OS=Brucella suis biovar 1 (strain 1330) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|C0RLD0|RL33_BRUMB 50S ribosomal protein L33 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A9WYS8|RL33_BRUSI 50S ribosomal protein L33 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A5VUU1|RL33_BRUO2 50S ribosomal protein L33 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|P66215|RL33_BRUME 50S ribosomal protein L33 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A9MBP9|RL33_BRUC2 50S ribosomal protein L33 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|Q578A8|RL33_BRUAB 50S ribosomal protein L33 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|Q2YKM8|RL33_BRUA2 50S ribosomal protein L33 OS=Brucella abortus (strain 2308) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|B2SB47|RL33_BRUA1 50S ribosomal protein L33 OS=Brucella abortus (strain S19) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|P66238|RL33_XANAC 50S ribosomal protein L33 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q3BMM6|RL33_XANC5 50S ribosomal protein L33 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q4UP62|RL33_XANC8 50S ribosomal protein L33 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|B0RYR2|RL33_XANCB 50S ribosomal protein L33 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|P66239|RL33_XANCP 50S ribosomal protein L33 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q2NXC6|RL33_XANOM 50S ribosomal protein L33 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q5GU11|RL33_XANOR 50S ribosomal protein L33 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|A1UT31|RL33_BARBK 50S ribosomal protein L33 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|B2IBG2|RL33_BEII9 50S ribosomal protein L33 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A6X578|RL33_OCHA4 50S ribosomal protein L33 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|C3MA88|RL33_RHISN 50S ribosomal protein L33 OS=Rhizobium sp. (strain NGR234) GN=rpmG PE=3 SV=1 68 119 4.0E-06
sp|Q2K9Q3|RL33_RHIEC 50S ribosomal protein L33 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpmG PE=3 SV=1 68 119 4.0E-06
sp|B3PW29|RL33_RHIE6 50S ribosomal protein L33 OS=Rhizobium etli (strain CIAT 652) GN=rpmG PE=3 SV=1 68 119 4.0E-06
sp|A9IU26|RL33_BART1 50S ribosomal protein L33 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpmG PE=3 SV=1 68 119 5.0E-06
sp|B2SU25|RL33_XANOP 50S ribosomal protein L33 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpmG PE=3 SV=1 68 117 5.0E-06
sp|Q6G3F9|RL33_BARHE 50S ribosomal protein L33 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpmG PE=3 SV=1 68 119 5.0E-06
sp|A5VA19|RL33_SPHWW 50S ribosomal protein L33 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpmG PE=3 SV=1 68 119 5.0E-06
sp|Q1MII4|RL33_RHIL3 50S ribosomal protein L33 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpmG PE=3 SV=1 68 119 7.0E-06
sp|B9JDL2|RL33_AGRRK 50S ribosomal protein L33 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpmG PE=3 SV=1 68 119 7.0E-06
sp|Q0BU03|RL33_GRABC 50S ribosomal protein L33 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpmG PE=3 SV=1 68 119 7.0E-06
sp|B8EMP5|RL33_METSB 50S ribosomal protein L33 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpmG PE=3 SV=1 68 119 8.0E-06
sp|B1LUW6|RL33_METRJ 50S ribosomal protein L33 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpmG PE=3 SV=1 68 119 8.0E-06
sp|Q1RGQ4|RL33_RICBR 50S ribosomal protein L33 OS=Rickettsia bellii (strain RML369-C) GN=rpmG PE=3 SV=1 64 117 8.0E-06
sp|A8GY80|RL33_RICB8 50S ribosomal protein L33 OS=Rickettsia bellii (strain OSU 85-389) GN=rpmG PE=3 SV=1 64 117 8.0E-06
sp|Q8UFU8|RL33_AGRFC 50S ribosomal protein L33 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpmG PE=3 SV=1 68 119 9.0E-06
sp|B1ZHG7|RL33_METPB 50S ribosomal protein L33 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpmG PE=3 SV=1 68 119 9.0E-06
sp|A9W3L4|RL33_METEP 50S ribosomal protein L33 OS=Methylobacterium extorquens (strain PA1) GN=rpmG PE=3 SV=1 68 119 9.0E-06
sp|B7KWY7|RL33_METC4 50S ribosomal protein L33 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpmG PE=3 SV=1 68 119 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 72 89 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 103.58 44.89 162.26
CcL In ants, during behavior modification 70.18 26.52 113.85
CcD In ants, recently dead 130.46 59.40 201.52

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.203222 no
SC16a CcD 0.442563 no
CcL CcD 0.026849 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|696
MHHDATSASQGHILPSELTSYSAPPFAGAGPPMFSRQRFHRHRQALIKYILVAAAPAPTPDPVMAKKAKSRLINV
RLISMAMTGFFYTFKRPRTSSMMGMLKYDPIIRKKVLFLETRRKSK
Coding >Ophio5|696
ATGCATCATGATGCCACCTCGGCCAGCCAGGGCCACATTTTGCCGTCGGAGCTAACCTCGTATTCGGCGCCACCT
TTCGCCGGCGCCGGACCGCCGATGTTTTCCCGCCAACGATTCCATCGCCATCGTCAAGCTCTCATCAAATATATC
TTGGTAGCCGCAGCTCCAGCTCCGACGCCCGACCCGGTCATGGCCAAGAAAGCCAAAAGTCGCCTGATTAACGTC
CGCCTCATCTCCATGGCCATGACAGGCTTCTTCTATACCTTCAAGCGCCCCCGAACCTCTTCTATGATGGGCATG
CTCAAATACGATCCGATAATTCGGAAAAAGGTCCTCTTCCTCGAGACGAGAAGGAAATCAAAA
Transcript >Ophio5|696
ATGCATCATGATGCCACCTCGGCCAGCCAGGGCCACATTTTGCCGTCGGAGCTAACCTCGTATTCGGCGCCACCT
TTCGCCGGCGCCGGACCGCCGATGTTTTCCCGCCAACGATTCCATCGCCATCGTCAAGCTCTCATCAAATATATC
TTGGTAGCCGCAGCTCCAGCTCCGACGCCCGACCCGGTCATGGCCAAGAAAGCCAAAAGTCGCCTGATTAACGTC
CGCCTCATCTCCATGGCCATGACAGGCTTCTTCTATACCTTCAAGCGCCCCCGAACCTCTTCTATGATGGGCATG
CTCAAATACGATCCGATAATTCGGAAAAAGGTCCTCTTCCTCGAGACGAGAAGGAAATCAAAATAA
Gene >Ophio5|696
ATGCATCATGATGCCACCTCGGCCAGCCAGGGCCACATTTTGCCGTCGGAGCTAACCTCGTATTCGGCGCCACCT
TTCGCCGGCGCCGGACCGCCGATGTTTTCCCGCCAACGATTCCATCGCCATCGTCAAGCTCTCATCAAATATATC
TTGGTAGCCGCAGCTCCAGCTCCGACGCCCGACCCGGTCATGGCCAAGAAAGGTGAGACCTCCTTCAGTTCATGT
TCAATCGATGCTGACGGCTTTTTTCGTGCAGCCAAAAGTCGCCTGATTAACGTCCGCCTCATCTCCATGGCCATG
ACAGGCTTCTTCTATACCTTCAAGCGCCCCCGAACCTCTTCTATGATGGGCATGCTCAAATACGATCCGATAAGT
GTGCCTCTCGCACCTGCCTCCCGTATACTTCTCCGCTGACTCGTCCTAGTTCGGAAAAAGGTCCTCTTCCTCGAG
ACGAGAAGGAAATCAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail