Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|696
Gene name
Locationscaffold_119:25006..25477
Strand-
Gene length (bp)471
Transcript length (bp)366
Coding sequence length (bp)363
Protein length (aa) 121

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74394|RM39_SCHPO 54S ribosomal protein L39, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl39 PE=3 SV=1 64 119 7.0E-10
sp|Q9CQP0|RM33_MOUSE 39S ribosomal protein L33, mitochondrial OS=Mus musculus GN=Mrpl33 PE=1 SV=1 67 118 2.0E-09
sp|Q3SZ47|RM33_BOVIN 39S ribosomal protein L33, mitochondrial OS=Bos taurus GN=MRPL33 PE=1 SV=1 67 118 1.0E-08
sp|O75394|RM33_HUMAN 39S ribosomal protein L33, mitochondrial OS=Homo sapiens GN=MRPL33 PE=1 SV=1 67 118 1.0E-07
sp|Q4RGM4|RM33_TETNG 39S ribosomal protein L33, mitochondrial OS=Tetraodon nigroviridis GN=mrpl33 PE=3 SV=1 67 118 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74394|RM39_SCHPO 54S ribosomal protein L39, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl39 PE=3 SV=1 64 119 7.0E-10
sp|Q9CQP0|RM33_MOUSE 39S ribosomal protein L33, mitochondrial OS=Mus musculus GN=Mrpl33 PE=1 SV=1 67 118 2.0E-09
sp|Q3SZ47|RM33_BOVIN 39S ribosomal protein L33, mitochondrial OS=Bos taurus GN=MRPL33 PE=1 SV=1 67 118 1.0E-08
sp|O75394|RM33_HUMAN 39S ribosomal protein L33, mitochondrial OS=Homo sapiens GN=MRPL33 PE=1 SV=1 67 118 1.0E-07
sp|Q4RGM4|RM33_TETNG 39S ribosomal protein L33, mitochondrial OS=Tetraodon nigroviridis GN=mrpl33 PE=3 SV=1 67 118 4.0E-07
sp|Q2G3F0|RL33_NOVAD 50S ribosomal protein L33 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpmG PE=3 SV=1 68 119 9.0E-07
sp|Q5FNN7|RL33_GLUOX 50S ribosomal protein L33 OS=Gluconobacter oxydans (strain 621H) GN=rpmG PE=3 SV=1 68 119 1.0E-06
sp|Q5NQY1|RL33_ZYMMO 50S ribosomal protein L33 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpmG PE=3 SV=1 68 119 1.0E-06
sp|B9JVH6|RL33_AGRVS 50S ribosomal protein L33 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpmG PE=3 SV=1 68 119 2.0E-06
sp|P66216|RL33_BRUSU 50S ribosomal protein L33 OS=Brucella suis biovar 1 (strain 1330) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|C0RLD0|RL33_BRUMB 50S ribosomal protein L33 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A9WYS8|RL33_BRUSI 50S ribosomal protein L33 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A5VUU1|RL33_BRUO2 50S ribosomal protein L33 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|P66215|RL33_BRUME 50S ribosomal protein L33 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A9MBP9|RL33_BRUC2 50S ribosomal protein L33 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|Q578A8|RL33_BRUAB 50S ribosomal protein L33 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|Q2YKM8|RL33_BRUA2 50S ribosomal protein L33 OS=Brucella abortus (strain 2308) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|B2SB47|RL33_BRUA1 50S ribosomal protein L33 OS=Brucella abortus (strain S19) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|P66238|RL33_XANAC 50S ribosomal protein L33 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q3BMM6|RL33_XANC5 50S ribosomal protein L33 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q4UP62|RL33_XANC8 50S ribosomal protein L33 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|B0RYR2|RL33_XANCB 50S ribosomal protein L33 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|P66239|RL33_XANCP 50S ribosomal protein L33 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q2NXC6|RL33_XANOM 50S ribosomal protein L33 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|Q5GU11|RL33_XANOR 50S ribosomal protein L33 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpmG PE=3 SV=1 68 117 3.0E-06
sp|A1UT31|RL33_BARBK 50S ribosomal protein L33 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|B2IBG2|RL33_BEII9 50S ribosomal protein L33 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|A6X578|RL33_OCHA4 50S ribosomal protein L33 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpmG PE=3 SV=1 68 119 3.0E-06
sp|C3MA88|RL33_RHISN 50S ribosomal protein L33 OS=Rhizobium sp. (strain NGR234) GN=rpmG PE=3 SV=1 68 119 4.0E-06
sp|Q2K9Q3|RL33_RHIEC 50S ribosomal protein L33 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpmG PE=3 SV=1 68 119 4.0E-06
sp|B3PW29|RL33_RHIE6 50S ribosomal protein L33 OS=Rhizobium etli (strain CIAT 652) GN=rpmG PE=3 SV=1 68 119 4.0E-06
sp|A9IU26|RL33_BART1 50S ribosomal protein L33 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpmG PE=3 SV=1 68 119 5.0E-06
sp|B2SU25|RL33_XANOP 50S ribosomal protein L33 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpmG PE=3 SV=1 68 117 5.0E-06
sp|Q6G3F9|RL33_BARHE 50S ribosomal protein L33 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpmG PE=3 SV=1 68 119 5.0E-06
sp|A5VA19|RL33_SPHWW 50S ribosomal protein L33 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpmG PE=3 SV=1 68 119 5.0E-06
sp|Q1MII4|RL33_RHIL3 50S ribosomal protein L33 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpmG PE=3 SV=1 68 119 7.0E-06
sp|B9JDL2|RL33_AGRRK 50S ribosomal protein L33 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpmG PE=3 SV=1 68 119 7.0E-06
sp|Q0BU03|RL33_GRABC 50S ribosomal protein L33 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpmG PE=3 SV=1 68 119 7.0E-06
sp|B8EMP5|RL33_METSB 50S ribosomal protein L33 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpmG PE=3 SV=1 68 119 8.0E-06
sp|B1LUW6|RL33_METRJ 50S ribosomal protein L33 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpmG PE=3 SV=1 68 119 8.0E-06
sp|Q1RGQ4|RL33_RICBR 50S ribosomal protein L33 OS=Rickettsia bellii (strain RML369-C) GN=rpmG PE=3 SV=1 64 117 8.0E-06
sp|A8GY80|RL33_RICB8 50S ribosomal protein L33 OS=Rickettsia bellii (strain OSU 85-389) GN=rpmG PE=3 SV=1 64 117 8.0E-06
sp|Q8UFU8|RL33_AGRFC 50S ribosomal protein L33 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpmG PE=3 SV=1 68 119 9.0E-06
sp|B1ZHG7|RL33_METPB 50S ribosomal protein L33 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpmG PE=3 SV=1 68 119 9.0E-06
sp|A9W3L4|RL33_METEP 50S ribosomal protein L33 OS=Methylobacterium extorquens (strain PA1) GN=rpmG PE=3 SV=1 68 119 9.0E-06
sp|B7KWY7|RL33_METC4 50S ribosomal protein L33 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpmG PE=3 SV=1 68 119 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 72 89 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|696
MHHDATSASQGHILPSELTSYSAPPFAGAGPPMFSRQRFHRHRQALIKYILVAAAPAPTPDPVMAKKAKSRLINV
RLISMAMTGFFYTFKRPRTSSMMGMLKYDPIIRKKVLFLETRRKSK
Coding >Ophio5|696
ATGCATCATGATGCCACCTCGGCCAGCCAGGGCCACATTTTGCCGTCGGAGCTAACCTCGTATTCGGCGCCACCT
TTCGCCGGCGCCGGACCGCCGATGTTTTCCCGCCAACGATTCCATCGCCATCGTCAAGCTCTCATCAAATATATC
TTGGTAGCCGCAGCTCCAGCTCCGACGCCCGACCCGGTCATGGCCAAGAAAGCCAAAAGTCGCCTGATTAACGTC
CGCCTCATCTCCATGGCCATGACAGGCTTCTTCTATACCTTCAAGCGCCCCCGAACCTCTTCTATGATGGGCATG
CTCAAATACGATCCGATAATTCGGAAAAAGGTCCTCTTCCTCGAGACGAGAAGGAAATCAAAA
Transcript >Ophio5|696
ATGCATCATGATGCCACCTCGGCCAGCCAGGGCCACATTTTGCCGTCGGAGCTAACCTCGTATTCGGCGCCACCT
TTCGCCGGCGCCGGACCGCCGATGTTTTCCCGCCAACGATTCCATCGCCATCGTCAAGCTCTCATCAAATATATC
TTGGTAGCCGCAGCTCCAGCTCCGACGCCCGACCCGGTCATGGCCAAGAAAGCCAAAAGTCGCCTGATTAACGTC
CGCCTCATCTCCATGGCCATGACAGGCTTCTTCTATACCTTCAAGCGCCCCCGAACCTCTTCTATGATGGGCATG
CTCAAATACGATCCGATAATTCGGAAAAAGGTCCTCTTCCTCGAGACGAGAAGGAAATCAAAATAA
Gene >Ophio5|696
ATGCATCATGATGCCACCTCGGCCAGCCAGGGCCACATTTTGCCGTCGGAGCTAACCTCGTATTCGGCGCCACCT
TTCGCCGGCGCCGGACCGCCGATGTTTTCCCGCCAACGATTCCATCGCCATCGTCAAGCTCTCATCAAATATATC
TTGGTAGCCGCAGCTCCAGCTCCGACGCCCGACCCGGTCATGGCCAAGAAAGGTGAGACCTCCTTCAGTTCATGT
TCAATCGATGCTGACGGCTTTTTTCGTGCAGCCAAAAGTCGCCTGATTAACGTCCGCCTCATCTCCATGGCCATG
ACAGGCTTCTTCTATACCTTCAAGCGCCCCCGAACCTCTTCTATGATGGGCATGCTCAAATACGATCCGATAAGT
GTGCCTCTCGCACCTGCCTCCCGTATACTTCTCCGCTGACTCGTCCTAGTTCGGAAAAAGGTCCTCTTCCTCGAG
ACGAGAAGGAAATCAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail