Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6954
Gene name
Locationscaffold_637:1263..2231
Strand+
Gene length (bp)968
Transcript length (bp)789
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 67 89 22
3 101 123 22
4 138 160 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.86 0.53 7.19
CcL In ants, during behavior modification 16.77 4.64 28.90
CcD In ants, recently dead 3.04 0.08 6.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.641833 no
CcL CcD 0.000770 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6954
MAWACHYLRLLKGTDQRTYRRVVWLTIFFIFFAHLGCALSLILACTPVAKSWNPLIDGSCLPPGPSFTGYAIVTI
VSDVIVALLPIPVLLKLNVRLEKKIGLIGIFMLGLFTTLCSIMRYTQINRIQYGDGNSTMLVLWGTIEFNVGNMV
SSLPFLAPVCMRKAKDYRSKYSGGSSHGHSRSRGRKNTDRFKLSDVSNDKTAFALSSKSKSASQDEILHDDTVAD
KRSHHSIVKSVTYTVQVDKDAEDQASYDRGHDEPSDV
Coding >Ophio5|6954
ATGGCTTGGGCCTGCCACTACCTGCGCCTGCTCAAGGGCACCGATCAGCGCACCTATCGCAGGGTCGTCTGGCTC
ACCATCTTTTTCATCTTCTTTGCCCATCTGGGTTGCGCCCTTTCGCTCATCCTCGCCTGCACCCCCGTGGCCAAA
TCCTGGAATCCCCTCATCGACGGCTCCTGTTTGCCGCCGGGGCCGTCCTTTACCGGCTACGCCATCGTCACCATC
GTCTCGGACGTTATTGTCGCCCTGCTGCCCATTCCGGTGCTGTTGAAGCTCAATGTCCGACTGGAAAAGAAGATT
GGCCTCATTGGCATCTTTATGCTCGGCCTCTTCACTACCCTCTGCTCCATCATGCGCTACACCCAGATCAACCGC
ATCCAGTACGGAGACGGCAACTCGACCATGTTGGTGCTCTGGGGAACCATCGAGTTCAACGTCGGCAACATGGTC
TCGTCACTGCCTTTCCTGGCCCCCGTCTGCATGAGAAAGGCCAAGGACTACCGATCTAAGTACTCGGGAGGCAGC
TCGCACGGCCACAGCCGGAGCCGGGGGCGCAAAAACACCGATCGCTTCAAGCTCAGCGACGTCAGCAACGACAAG
ACGGCCTTTGCCCTGTCTTCCAAGTCCAAGTCGGCCAGCCAAGACGAAATCTTGCACGACGATACCGTCGCCGAC
AAGAGAAGTCACCACTCCATCGTCAAGTCCGTCACCTACACCGTCCAAGTCGACAAGGACGCCGAGGACCAGGCT
AGCTATGACCGCGGTCACGACGAGCCGTCTGATGTG
Transcript >Ophio5|6954
ATGGCTTGGGCCTGCCACTACCTGCGCCTGCTCAAGGGCACCGATCAGCGCACCTATCGCAGGGTCGTCTGGCTC
ACCATCTTTTTCATCTTCTTTGCCCATCTGGGTTGCGCCCTTTCGCTCATCCTCGCCTGCACCCCCGTGGCCAAA
TCCTGGAATCCCCTCATCGACGGCTCCTGTTTGCCGCCGGGGCCGTCCTTTACCGGCTACGCCATCGTCACCATC
GTCTCGGACGTTATTGTCGCCCTGCTGCCCATTCCGGTGCTGTTGAAGCTCAATGTCCGACTGGAAAAGAAGATT
GGCCTCATTGGCATCTTTATGCTCGGCCTCTTCACTACCCTCTGCTCCATCATGCGCTACACCCAGATCAACCGC
ATCCAGTACGGAGACGGCAACTCGACCATGTTGGTGCTCTGGGGAACCATCGAGTTCAACGTCGGCAACATGGTC
TCGTCACTGCCTTTCCTGGCCCCCGTCTGCATGAGAAAGGCCAAGGACTACCGATCTAAGTACTCGGGAGGCAGC
TCGCACGGCCACAGCCGGAGCCGGGGGCGCAAAAACACCGATCGCTTCAAGCTCAGCGACGTCAGCAACGACAAG
ACGGCCTTTGCCCTGTCTTCCAAGTCCAAGTCGGCCAGCCAAGACGAAATCTTGCACGACGATACCGTCGCCGAC
AAGAGAAGTCACCACTCCATCGTCAAGTCCGTCACCTACACCGTCCAAGTCGACAAGGACGCCGAGGACCAGGCT
AGCTATGACCGCGGTCACGACGAGCCGTCTGATGTGTAA
Gene >Ophio5|6954
ATGGCTTGGGCCTGCCAGTCAAGTTGAGGCCCAAAGCCAACCTCATCCCTTACACGCGCGTCAACTTCGCCGGCC
GTCCCATCTATCAGCTCGGCATCTCCTTCTTCAAGGTGGCGCTTTGCATCAGCTACCTGCGCCTGCTCAAGGGCA
CCGATCAGCGCACCTATCGCAGGGTCGTCTGGCTCACCATCTTTTTCATCTTCTTTGCCCATCTGGGTTGCGCCC
TTTCGCTCATCCTCGCCTGCACCCCCGTGGCCAAATCCTGGAATCCCCTCATCGACGGCTCCTGTTTGCCGCCGG
GGCCGTCCTTTACCGGCTACGCCATCGTCACCATCGTCTCGGACGTTATTGTCGCCCTGCTGCCCATTCCGGTGC
TGTTGAAGCTCAATGTCCGACTGGAAAAGAAGATTGGCCTCATTGGCATCTTTATGCTCGGCCTCTTCACTACCC
TCTGCTCCATCATGCGCTACACCCAGATCAACCGCATCCAGTACGGAGACGGCAACTCGACCATGTTGGTGCTCT
GGGGAACCATCGAGTTCAACGTCGGCGTATGTAATCTCGTCCATTCCATTCATATACATGTCATGTATTCGAGCT
GACCTTTGTTTGCCTCTCAGAACATGGTCTCGTCACTGCCTTTCCTGGCCCCCGTCTGCATGAGAAAGGCCAAGG
ACTACCGATCTAAGTACTCGGGAGGCAGCTCGCACGGCCACAGCCGGAGCCGGGGGCGCAAAAACACCGATCGCT
TCAAGCTCAGCGACGTCAGCAACGACAAGACGGCCTTTGCCCTGTCTTCCAAGTCCAAGTCGGCCAGCCAAGACG
AAATCTTGCACGACGATACCGTCGCCGACAAGAGAAGTCACCACTCCATCGTCAAGTCCGTCACCTACACCGTCC
AAGTCGACAAGGACGCCGAGGACCAGGCTAGCTATGACCGCGGTCACGACGAGCCGTCTGATGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail