Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6942
Gene name
Locationscaffold_634:3536..5711
Strand-
Gene length (bp)2175
Transcript length (bp)2052
Coding sequence length (bp)2049
Protein length (aa) 683

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09731 Mitofilin Mitochondrial inner membrane protein 1.7E-22 143 305
PF09731 Mitofilin Mitochondrial inner membrane protein 4.2E-123 321 676

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D1Z5G1|MIC60_SORMK MICOS complex subunit MIC60 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MIC60 PE=3 SV=1 1 683 0.0E+00
sp|C7YIH6|MIC60_NECH7 MICOS complex subunit MIC60 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MIC60 PE=3 SV=1 1 683 0.0E+00
sp|A7F6C1|MIC60_SCLS1 MICOS complex subunit mic60 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mic60 PE=3 SV=1 165 669 0.0E+00
sp|Q7SFD8|MIC60_NEUCR MICOS complex subunit mic60 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic60 PE=3 SV=1 137 683 0.0E+00
sp|Q0V4H8|MIC60_PHANO MICOS complex subunit MIC60 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MIC60 PE=3 SV=2 1 683 2.0E-166
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D1Z5G1|MIC60_SORMK MICOS complex subunit MIC60 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=MIC60 PE=3 SV=1 1 683 0.0E+00
sp|C7YIH6|MIC60_NECH7 MICOS complex subunit MIC60 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=MIC60 PE=3 SV=1 1 683 0.0E+00
sp|A7F6C1|MIC60_SCLS1 MICOS complex subunit mic60 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mic60 PE=3 SV=1 165 669 0.0E+00
sp|Q7SFD8|MIC60_NEUCR MICOS complex subunit mic60 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic60 PE=3 SV=1 137 683 0.0E+00
sp|Q0V4H8|MIC60_PHANO MICOS complex subunit MIC60 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MIC60 PE=3 SV=2 1 683 2.0E-166
sp|A1CHB5|MIC60_ASPCL MICOS complex subunit mic60 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mic60 PE=3 SV=1 120 683 2.0E-164
sp|B2WBQ6|MIC60_PYRTR MICOS complex subunit MIC60 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=MIC60 PE=3 SV=1 1 683 4.0E-163
sp|C6H203|MIC60_AJECH MICOS complex subunit MIC60 OS=Ajellomyces capsulatus (strain H143) GN=MIC60 PE=3 SV=1 1 683 4.0E-161
sp|Q5B6I7|MIC60_EMENI MICOS complex subunit mic60 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mic60 PE=3 SV=1 1 683 7.0E-161
sp|C5GFG7|MIC60_AJEDR MICOS complex subunit MIC60 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MIC60 PE=3 SV=1 155 683 3.0E-159
sp|C5JIS0|MIC60_AJEDS MICOS complex subunit MIC60 OS=Ajellomyces dermatitidis (strain SLH14081) GN=MIC60 PE=3 SV=1 155 683 5.0E-159
sp|C4JHS3|MIC60_UNCRE MICOS complex subunit MIC60 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MIC60 PE=3 SV=1 155 683 7.0E-158
sp|C0RYV1|MIC60_PARBP MICOS complex subunit MIC60 OS=Paracoccidioides brasiliensis (strain Pb03) GN=MIC60 PE=3 SV=2 143 683 8.0E-158
sp|C1G784|MIC60_PARBD MICOS complex subunit MIC60 OS=Paracoccidioides brasiliensis (strain Pb18) GN=MIC60 PE=3 SV=2 143 683 8.0E-158
sp|D4ANR0|MIC60_ARTBC MICOS complex subunit MIC60 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MIC60 PE=3 SV=1 115 671 3.0E-157
sp|D4DHX2|MIC60_TRIVH MICOS complex subunit MIC60 OS=Trichophyton verrucosum (strain HKI 0517) GN=MIC60 PE=3 SV=1 115 671 4.0E-157
sp|C0NUJ9|MIC60_AJECG MICOS complex subunit MIC60 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MIC60 PE=3 SV=1 1 683 2.0E-156
sp|B8MJK3|MIC60_TALSN MICOS complex subunit MIC60 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=MIC60 PE=3 SV=1 143 683 1.0E-154
sp|C1GYK6|MIC60_PARBA MICOS complex subunit MIC60 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=MIC60 PE=3 SV=1 155 683 5.0E-154
sp|A6RBC5|MIC60_AJECN MICOS complex subunit MIC60 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MIC60 PE=3 SV=1 143 683 3.0E-153
sp|A2QI68|MIC60_ASPNC MICOS complex subunit mic60 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mic60 PE=3 SV=1 158 683 5.0E-153
sp|B6QHK6|MIC60_TALMQ MICOS complex subunit mic60 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mic60 PE=3 SV=1 102 683 7.0E-152
sp|B6H457|MIC60_PENRW MICOS complex subunit mic60 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mic60 PE=3 SV=1 143 683 4.0E-151
sp|C5P436|MIC60_COCP7 MICOS complex subunit MIC60 OS=Coccidioides posadasii (strain C735) GN=MIC60 PE=3 SV=1 143 683 5.0E-151
sp|A1CXH2|MIC60_NEOFI MICOS complex subunit MIC60 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=MIC60 PE=3 SV=1 143 683 7.0E-150
sp|C5FGB1|MIC60_ARTOC MICOS complex subunit MIC60 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MIC60 PE=3 SV=1 1 657 2.0E-145
sp|Q4WP49|MIC60_ASPFU MICOS complex subunit mic60 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mic60 PE=3 SV=1 143 670 3.0E-141
sp|B0Y5Z6|MIC60_ASPFC MICOS complex subunit mic60 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mic60 PE=3 SV=1 143 670 3.0E-141
sp|Q6C060|MIC60_YARLI MICOS complex subunit MIC60 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MIC60 PE=3 SV=1 121 677 2.0E-59
sp|A5DSD2|MIC60_LODEL MICOS complex subunit MIC60 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MIC60 PE=3 SV=1 79 677 9.0E-40
sp|B9WLF1|MIC60_CANDC MICOS complex subunit MIC60 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MIC60 PE=3 SV=1 144 677 3.0E-34
sp|Q5A044|MIC60_CANAL MICOS complex subunit MIC60 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MIC60 PE=3 SV=1 144 677 6.0E-33
sp|C4YLH0|MIC60_CANAW MICOS complex subunit MIC60 OS=Candida albicans (strain WO-1) GN=MIC60 PE=3 SV=1 144 677 2.0E-32
sp|C5M3V6|MIC60_CANTT MICOS complex subunit MIC60 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MIC60 PE=3 SV=1 144 677 3.0E-29
sp|O59725|MIC60_SCHPO MICOS complex subunit mic60 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mic60 PE=3 SV=1 155 679 6.0E-28
sp|Q6BXM9|MIC60_DEBHA MICOS complex subunit MIC60 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MIC60 PE=3 SV=2 327 677 8.0E-28
sp|C4QXN2|MIC60_PICPG MICOS complex subunit MIC60 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MIC60 PE=3 SV=1 311 677 8.0E-26
sp|A3LQS0|MIC60_PICST MICOS complex subunit MIC60 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MIC60 PE=3 SV=2 144 677 2.0E-23
sp|C5E325|MIC60_LACTC MICOS complex subunit MIC60 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MIC60 PE=3 SV=1 143 676 3.0E-23
sp|A5D9S8|MIC60_PICGU MICOS complex subunit MIC60 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MIC60 PE=3 SV=2 147 676 6.0E-23
sp|Q6CSB8|MIC60_KLULA MICOS complex subunit MIC60 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIC60 PE=3 SV=1 368 676 8.0E-23
sp|Q6FSU7|MIC60_CANGA MICOS complex subunit MIC60 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MIC60 PE=3 SV=1 324 676 2.0E-22
sp|Q754G4|MIC60_ASHGO MICOS complex subunit MIC60 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MIC60 PE=3 SV=2 364 676 3.0E-20
sp|A7TSS9|MIC60_VANPO MICOS complex subunit MIC60 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MIC60 PE=3 SV=1 311 676 2.0E-19
sp|P36112|MIC60_YEAST MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC60 PE=1 SV=1 324 676 5.0E-19
sp|A6ZZY0|MIC60_YEAS7 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain YJM789) GN=MIC60 PE=3 SV=1 324 676 6.0E-19
sp|B3LRA0|MIC60_YEAS1 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MIC60 PE=3 SV=1 324 676 6.0E-19
sp|C8ZCI0|MIC60_YEAS8 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MIC60 PE=3 SV=1 324 676 8.0E-19
sp|B5VMG3|MIC60_YEAS6 MICOS complex subunit MIC60 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MIC60 PE=3 SV=1 324 676 2.0E-18
sp|Q16891|MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens GN=IMMT PE=1 SV=1 415 675 4.0E-12
sp|P91928|MIC60_DROME MICOS complex subunit Mic60 OS=Drosophila melanogaster GN=Mitofilin PE=1 SV=4 428 675 3.0E-11
sp|Q8CAQ8|MIC60_MOUSE MICOS complex subunit Mic60 OS=Mus musculus GN=Immt PE=1 SV=1 415 675 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 147 166 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 78.29 41.98 114.60
CcL In ants, during behavior modification 70.82 38.14 103.49
CcD In ants, recently dead 102.13 52.93 151.33

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.715169 no
SC16a CcD 0.281145 no
CcL CcD 0.125471 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6942
MLRSSLRSARPVGVAPFAAAARRQWAVAVTHRASLSGNRSFSDRKTAGSGMPETPVLPSSKTLTSQRAAPPDDLG
KPKLGAATKLPVTPPTPEEASGGRLRPPSTIGDVGESKFPQKDWPAAPPPPPPPPPPPPPPRKSFARRLRNLVLG
VVLLGMAGFGGGALYSRSNDNFHDFFTEYIPYGEQAVLYLEEMDYKKKFPHIRGRGSPASRDDNQQVKISAQSGA
SWRVADGGEPSGRHSNASSKTRDSAGSSPTTSENETARDSSTKSKAPELVAKSSKKATPRIVDTSGKRLENVKEP
EVNEPSKFPALQSIDLMSLPDAKEPIVRDLVHMLNDLILVINADGAHARYGTTIEKAKKDVENIGSRLQAMKSDV
QKKAAAEVKSSIGEFEKAATDLIQRVDKTMLAQEMDWRREFEQEMKAVRDSYDQRVQLLMEREQKLNKELLENKL
LEQALALKREFVQEVKSQVEQERQGRLGKLAELSSTVSELEKLMAGWNEVLESNLKTQQLHVAVEAVRASLEDGQ
NPRPFIRELVALKEIATDDAVVDAAIASVNPAAYQRGLPTSLQLVDRFRRVASEVRKASLLPEDAGVASHASSWA
LSHLLFKKQGLASGSDVESILTRAQSYLEEGNLDSAAREMNGLQGWAKTLSRDWLGEVRKVLEVQQALDVIATEA
RLQSLRAD
Coding >Ophio5|6942
ATGCTGCGATCATCGCTCCGGTCGGCGAGGCCGGTGGGCGTAGCGCCCTTTGCGGCTGCTGCTCGTCGCCAATGG
GCCGTCGCGGTGACGCATCGTGCCAGTCTGTCGGGTAACAGGTCCTTTTCCGACCGGAAGACGGCCGGCTCCGGA
ATGCCCGAGACGCCCGTGCTTCCCTCGTCCAAGACGTTGACCTCTCAGCGCGCCGCGCCGCCCGACGACCTCGGC
AAGCCCAAGCTCGGAGCTGCCACGAAGCTACCGGTGACACCTCCAACCCCGGAGGAGGCTTCTGGCGGGCGGCTT
CGACCCCCATCGACCATCGGTGACGTCGGAGAGTCGAAATTTCCCCAGAAAGACTGGCCGGCAGCACCGCCTCCG
CCTCCGCCTCCGCCTCCGCCTCCACCGCCTCCGAGGAAGAGCTTCGCGCGTCGACTGAGGAACCTGGTTCTCGGC
GTAGTGCTGCTGGGCATGGCCGGCTTCGGTGGAGGTGCCTTGTACTCGCGGAGCAACGACAACTTTCACGACTTC
TTCACCGAATACATTCCCTACGGAGAACAGGCCGTCTTGTACCTGGAGGAGATGGACTATAAGAAGAAGTTCCCG
CACATAAGAGGACGTGGGTCGCCTGCGTCCCGCGACGACAACCAGCAGGTCAAGATTTCTGCGCAGAGCGGCGCC
TCGTGGAGGGTTGCCGACGGCGGTGAGCCCAGCGGGCGACACTCTAACGCCTCTTCGAAGACCAGGGACTCGGCG
GGCAGTTCACCGACGACGTCCGAGAACGAGACGGCCAGGGACTCTTCGACCAAGTCTAAAGCCCCCGAGTTAGTC
GCCAAGTCTTCTAAGAAGGCCACCCCCAGAATCGTCGACACAAGCGGAAAGAGGTTGGAGAATGTCAAAGAACCC
GAAGTCAACGAGCCGTCCAAGTTCCCCGCCCTACAGTCGATCGACCTCATGTCGCTGCCAGACGCCAAGGAGCCC
ATTGTCAGAGATCTCGTACACATGCTGAATGACCTGATTCTGGTCATTAACGCTGATGGCGCTCATGCAAGGTAC
GGCACGACTATCGAAAAGGCCAAGAAGGACGTGGAAAACATCGGCTCGAGGCTCCAGGCGATGAAGAGCGACGTG
CAGAAGAAGGCTGCGGCTGAGGTCAAGTCGTCGATTGGTGAGTTCGAAAAAGCCGCCACTGATCTTATCCAGCGG
GTGGACAAGACGATGCTGGCGCAGGAGATGGATTGGCGACGGGAATTCGAGCAGGAAATGAAGGCAGTTCGCGAC
AGCTACGACCAACGAGTCCAGCTCTTGATGGAGCGGGAACAGAAGCTCAACAAGGAGCTGCTCGAGAACAAGCTC
CTGGAACAGGCCTTGGCCCTGAAGCGGGAGTTTGTGCAGGAAGTCAAGAGTCAGGTGGAGCAAGAGCGACAAGGC
CGGCTGGGCAAGCTGGCGGAGCTGTCGTCGACGGTTTCGGAGCTGGAGAAGCTGATGGCGGGCTGGAACGAGGTG
CTGGAGAGCAACCTCAAGACGCAACAGCTGCACGTGGCGGTGGAGGCGGTGCGGGCCAGCCTGGAGGACGGGCAG
AACCCGCGGCCTTTTATCCGGGAGCTGGTGGCGCTCAAGGAGATTGCGACGGACGACGCTGTGGTGGACGCGGCC
ATCGCTTCGGTCAACCCGGCCGCCTACCAGCGAGGGCTCCCGACGTCGTTGCAGCTGGTGGACCGGTTCCGGCGG
GTGGCGAGCGAGGTACGAAAGGCGTCGTTGCTACCGGAAGACGCCGGGGTGGCGAGCCACGCTTCGAGCTGGGCC
CTCAGCCACCTACTCTTCAAGAAGCAGGGCCTGGCTTCCGGCAGCGACGTGGAGAGCATCCTGACGCGAGCGCAG
TCGTACCTGGAGGAGGGCAACCTGGACTCCGCCGCGCGGGAGATGAACGGGCTGCAGGGATGGGCCAAGACGCTC
AGCAGGGACTGGCTGGGCGAGGTGCGCAAGGTGCTGGAGGTGCAGCAGGCGCTTGATGTCATTGCGACGGAGGCG
CGGCTACAGAGCCTCAGGGCGGAT
Transcript >Ophio5|6942
ATGCTGCGATCATCGCTCCGGTCGGCGAGGCCGGTGGGCGTAGCGCCCTTTGCGGCTGCTGCTCGTCGCCAATGG
GCCGTCGCGGTGACGCATCGTGCCAGTCTGTCGGGTAACAGGTCCTTTTCCGACCGGAAGACGGCCGGCTCCGGA
ATGCCCGAGACGCCCGTGCTTCCCTCGTCCAAGACGTTGACCTCTCAGCGCGCCGCGCCGCCCGACGACCTCGGC
AAGCCCAAGCTCGGAGCTGCCACGAAGCTACCGGTGACACCTCCAACCCCGGAGGAGGCTTCTGGCGGGCGGCTT
CGACCCCCATCGACCATCGGTGACGTCGGAGAGTCGAAATTTCCCCAGAAAGACTGGCCGGCAGCACCGCCTCCG
CCTCCGCCTCCGCCTCCGCCTCCACCGCCTCCGAGGAAGAGCTTCGCGCGTCGACTGAGGAACCTGGTTCTCGGC
GTAGTGCTGCTGGGCATGGCCGGCTTCGGTGGAGGTGCCTTGTACTCGCGGAGCAACGACAACTTTCACGACTTC
TTCACCGAATACATTCCCTACGGAGAACAGGCCGTCTTGTACCTGGAGGAGATGGACTATAAGAAGAAGTTCCCG
CACATAAGAGGACGTGGGTCGCCTGCGTCCCGCGACGACAACCAGCAGGTCAAGATTTCTGCGCAGAGCGGCGCC
TCGTGGAGGGTTGCCGACGGCGGTGAGCCCAGCGGGCGACACTCTAACGCCTCTTCGAAGACCAGGGACTCGGCG
GGCAGTTCACCGACGACGTCCGAGAACGAGACGGCCAGGGACTCTTCGACCAAGTCTAAAGCCCCCGAGTTAGTC
GCCAAGTCTTCTAAGAAGGCCACCCCCAGAATCGTCGACACAAGCGGAAAGAGGTTGGAGAATGTCAAAGAACCC
GAAGTCAACGAGCCGTCCAAGTTCCCCGCCCTACAGTCGATCGACCTCATGTCGCTGCCAGACGCCAAGGAGCCC
ATTGTCAGAGATCTCGTACACATGCTGAATGACCTGATTCTGGTCATTAACGCTGATGGCGCTCATGCAAGGTAC
GGCACGACTATCGAAAAGGCCAAGAAGGACGTGGAAAACATCGGCTCGAGGCTCCAGGCGATGAAGAGCGACGTG
CAGAAGAAGGCTGCGGCTGAGGTCAAGTCGTCGATTGGTGAGTTCGAAAAAGCCGCCACTGATCTTATCCAGCGG
GTGGACAAGACGATGCTGGCGCAGGAGATGGATTGGCGACGGGAATTCGAGCAGGAAATGAAGGCAGTTCGCGAC
AGCTACGACCAACGAGTCCAGCTCTTGATGGAGCGGGAACAGAAGCTCAACAAGGAGCTGCTCGAGAACAAGCTC
CTGGAACAGGCCTTGGCCCTGAAGCGGGAGTTTGTGCAGGAAGTCAAGAGTCAGGTGGAGCAAGAGCGACAAGGC
CGGCTGGGCAAGCTGGCGGAGCTGTCGTCGACGGTTTCGGAGCTGGAGAAGCTGATGGCGGGCTGGAACGAGGTG
CTGGAGAGCAACCTCAAGACGCAACAGCTGCACGTGGCGGTGGAGGCGGTGCGGGCCAGCCTGGAGGACGGGCAG
AACCCGCGGCCTTTTATCCGGGAGCTGGTGGCGCTCAAGGAGATTGCGACGGACGACGCTGTGGTGGACGCGGCC
ATCGCTTCGGTCAACCCGGCCGCCTACCAGCGAGGGCTCCCGACGTCGTTGCAGCTGGTGGACCGGTTCCGGCGG
GTGGCGAGCGAGGTACGAAAGGCGTCGTTGCTACCGGAAGACGCCGGGGTGGCGAGCCACGCTTCGAGCTGGGCC
CTCAGCCACCTACTCTTCAAGAAGCAGGGCCTGGCTTCCGGCAGCGACGTGGAGAGCATCCTGACGCGAGCGCAG
TCGTACCTGGAGGAGGGCAACCTGGACTCCGCCGCGCGGGAGATGAACGGGCTGCAGGGATGGGCCAAGACGCTC
AGCAGGGACTGGCTGGGCGAGGTGCGCAAGGTGCTGGAGGTGCAGCAGGCGCTTGATGTCATTGCGACGGAGGCG
CGGCTACAGAGCCTCAGGGCGGATTGA
Gene >Ophio5|6942
ATGCTGCGATCATCGCTCCGGTCGGCGAGGCCGGTGGGCGTAGCGCCCTTTGCGGCTGCTGCTCGTCGCCAATGG
GCCGTCGCGGTGACGCATCGTGCCAGTCTGTCGGGTAACGTACGCTAGCCAGGCCACCAGCTTCATGTGCAAGAG
ATGAGCTCTGACCAGCTTCACAGAGGTCCTTTTCCGACCGGAAGACGGCCGGCTCCGGAATGCCCGAGACGCCCG
TGCTTCCCTCGTCCAAGACGTTGACCTCTCAGCGCGCCGCGCCGCCCGACGACCTCGGCAAGCCCAAGCTCGGAG
CTGCCACGAAGCTACCGGTGACACCTCCAACCCCGGAGGAGGCTTCTGGCGGGCGGCTTCGACCCCCATCGACCA
TCGGTGACGTCGGAGAGTCGAAATTTCCCCAGAAAGACTGGCCGGCAGCACCGCCTCCGCCTCCGCCTCCGCCTC
CGCCTCCACCGCCTCCGAGGAAGAGCTTCGCGCGTCGACTGAGGAACCTGGTTCTCGGCGTAGTGCTGCTGGGCA
TGGCCGGCTTCGGTGGAGGTGCCTTGTACTCGCGGAGCAACGACAACTTTCACGACTTCTTCACCGAATACATTC
CCTACGGAGAACAGGCCGTCTTGTACCTGGAGGAGATGGACTATAAGAAGAAGTTCCCGCACATAAGAGGACGTG
GGTCGCCTGCGTCCCGCGACGACAACCAGCAGGTCAAGATTTCTGCGCAGAGCGGCGCCTCGTGGAGGGTTGCCG
ACGGCGGTGAGCCCAGCGGGCGACACTCTAACGCCTCTTCGAAGACCAGGGACTCGGCGGGCAGTTCACCGACGA
CGTCCGAGAACGAGACGGCCAGGGACTCTTCGACCAAGTCTAAAGCCCCCGAGTTAGTCGCCAAGTCTTCTAAGA
AGGCCACCCCCAGAATCGTCGACACAAGCGGAAAGAGGTTGGAGAATGTCAAAGAACCCGAAGTCAACGAGCCGT
CCAAGTTCCCCGCCCTACAGTCGATCGACCTCATGTCGCTGCCAGACGCCAAGGAGCCCATTGTCAGAGATCTCG
TACACATGCTGAATGACCTGATTCTGGTCATTAACGCTGATGGCGCTCATGCAAGGTACGGCACGACTATCGAAA
AGGCCAAGAAGGACGTGGAAAACATCGGCTCGAGGCTCCAGGCGATGAAGAGCGACGTGCAGAAGAAGGCTGCGG
CTGAGGTCAAGTCGTCGATTGGTGAGTTCGAAAAAGCCGCCACTGATCTTATCCAGCGGGTGGACAAGACGATGC
TGGCGCAGGAGATGGATTGGCGACGGGAATTCGAGCAGGAAATGAAGGCAGTTCGCGACAGCTACGACCAACGAG
TCCAGCTCTTGATGGAGCGGGAACAGAAGCTCAACAAGGAGCTGCTCGAGAACAAGCTCCTGGAACAGGCCTTGG
CCCTGAAGCGGGAGTTTGTGCAGGAAGTCAAGAGTCAGGTGGAGCAAGAGCGACAAGGCCGGCTGGGCAAGCTGG
CGGAGCTGTCGTCGACGGTTTCGGAGCTGGAGAAGCTGATGGCGGGCTGGAACGAGGTGCTGGAGAGCAACCTCA
AGACGCAACAGCTGCACGTGGCGGTGGAGGCGGTGCGGGCCAGCCTGGAGGACGGGCAGAACCCGCGGCCTTTTA
TCCGGGAGCTGGTGGCGCTCAAGGAGATTGCGACGGACGACGCTGTGGTGGACGCGGCCATCGCTTCGGTCAACC
CGGCCGCCTACCAGCGAGGGCTCCCGACGTCGTTGCAGCTGGTGGACCGGTTCCGGCGGGTGGCGAGCGAGGTAC
GAAAGGCGTCGTTGCTACCGGAAGACGCCGGGGTGGCGAGCCACGCTTCGAGCTGGGCCCTCAGCCACCTACTCT
TCAAGAAGCAGGGCCTGGCTTCCGGCAGCGACGTGGAGAGCATCCTGACGCGAGCGCAGTCGTACCTGGAGGAGG
GCAACCTGGACTCCGCCGCGCGGGAGATGAACGGGCTGCAGGGATGGGCCAAGACGCTCAGCAGGGACTGGCTGG
GCGAGGTGCGCAAGGTGCTGGAGGTGCAGCAGGCGCTTGATGTAAGTTGACGTCCGTTGTTTGGAGGGTCTTGGT
CCTCTGCTAATACTGGCTGTCGATTTCTAGGTCATTGCGACGGAGGCGCGGCTACAGAGCCTCAGGGCGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail