Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6935
Gene name
Locationscaffold_632:8391..9475
Strand+
Gene length (bp)1084
Transcript length (bp)855
Coding sequence length (bp)852
Protein length (aa) 284

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10590 PNP_phzG_C Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region 3.2E-19 242 284
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 2.6E-17 95 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38075|PDX3_YEAST Pyridoxamine 5'-phosphate oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDX3 PE=1 SV=1 53 284 4.0E-62
sp|Q9UTQ1|PDX3_SCHPO Probable pyridoxamine 5'-phosphate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.02 PE=3 SV=1 54 284 1.0E-55
sp|A1SUY2|PDXH_PSYIN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychromonas ingrahamii (strain 37) GN=pdxH PE=3 SV=1 69 284 6.0E-53
sp|Q1ATH8|PDXH_RUBXD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pdxH PE=3 SV=2 68 284 2.0E-52
sp|B1WR90|PDXH_CYAA5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain ATCC 51142) GN=pdxH PE=3 SV=1 67 284 8.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38075|PDX3_YEAST Pyridoxamine 5'-phosphate oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDX3 PE=1 SV=1 53 284 4.0E-62
sp|Q9UTQ1|PDX3_SCHPO Probable pyridoxamine 5'-phosphate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.02 PE=3 SV=1 54 284 1.0E-55
sp|A1SUY2|PDXH_PSYIN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychromonas ingrahamii (strain 37) GN=pdxH PE=3 SV=1 69 284 6.0E-53
sp|Q1ATH8|PDXH_RUBXD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pdxH PE=3 SV=2 68 284 2.0E-52
sp|B1WR90|PDXH_CYAA5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain ATCC 51142) GN=pdxH PE=3 SV=1 67 284 8.0E-50
sp|B2IX27|PDXH_NOSP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pdxH PE=3 SV=1 69 284 2.0E-49
sp|Q82GN9|PDXH_STRAW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pdxH PE=3 SV=1 54 284 3.0E-49
sp|Q8YXG5|PDXH_NOSS1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pdxH PE=3 SV=1 69 284 7.0E-49
sp|Q3MFQ5|PDXH_ANAVT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pdxH PE=3 SV=1 69 284 1.0E-48
sp|B2JDT0|PDXH_BURP8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pdxH PE=3 SV=1 67 284 3.0E-48
sp|B7JZR4|PDXH_CYAP8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain PCC 8801) GN=pdxH PE=3 SV=1 67 284 5.0E-48
sp|Q9K3V7|PDXH_STRCO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pdxH PE=3 SV=1 52 284 1.0E-47
sp|B0C079|PDXH_ACAM1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acaryochloris marina (strain MBIC 11017) GN=pdxH PE=3 SV=1 59 284 2.0E-46
sp|Q7V3Y6|PDXH_PROMM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Prochlorococcus marinus (strain MIT 9313) GN=pdxH PE=3 SV=1 69 284 2.0E-46
sp|B7K9I2|PDXH_CYAP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain PCC 7424) GN=pdxH PE=3 SV=1 67 284 2.0E-46
sp|B2SY78|PDXH_BURPP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=pdxH PE=3 SV=1 67 284 3.0E-46
sp|Q2S544|PDXH_SALRD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pdxH PE=3 SV=1 67 284 3.0E-46
sp|Q13UP6|PDXH_BURXL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia xenovorans (strain LB400) GN=pdxH PE=3 SV=1 67 284 3.0E-46
sp|A2CDU4|PDXH_PROM3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Prochlorococcus marinus (strain MIT 9303) GN=pdxH PE=3 SV=1 69 284 4.0E-46
sp|Q2SDP4|PDXH_HAHCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Hahella chejuensis (strain KCTC 2396) GN=pdxH PE=3 SV=1 68 284 5.0E-46
sp|A1AW86|PDXH_RUTMC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=pdxH PE=3 SV=1 67 284 8.0E-46
sp|Q0K7Z0|PDXH_CUPNH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pdxH PE=3 SV=1 69 284 9.0E-46
sp|B3R5Q8|PDXH_CUPTR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pdxH PE=3 SV=1 69 284 1.0E-45
sp|Q487G8|PDXH_COLP3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pdxH PE=3 SV=1 69 284 2.0E-45
sp|C5BN92|PDXH_TERTT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pdxH PE=3 SV=1 68 284 3.0E-45
sp|Q0RUF3|PDXH_FRAAA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Frankia alni (strain ACN14a) GN=pdxH PE=3 SV=1 62 284 7.0E-45
sp|Q7UKQ9|PDXH_RHOBA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pdxH PE=3 SV=1 67 284 7.0E-45
sp|Q2T0M6|PDXH_BURTA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pdxH PE=3 SV=2 68 284 1.0E-44
sp|A1TWZ3|PDXH_MARHV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pdxH PE=3 SV=1 69 284 2.0E-44
sp|A4JHA1|PDXH_BURVG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pdxH PE=3 SV=1 68 284 2.0E-44
sp|Q63WN7|PDXH_BURPS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain K96243) GN=pdxH PE=3 SV=2 68 284 3.0E-44
sp|A3N6I1|PDXH_BURP6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain 668) GN=pdxH PE=3 SV=1 68 284 3.0E-44
sp|Q3JVD0|PDXH_BURP1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain 1710b) GN=pdxH PE=3 SV=2 68 284 3.0E-44
sp|A3NS64|PDXH_BURP0 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia pseudomallei (strain 1106a) GN=pdxH PE=3 SV=1 68 284 3.0E-44
sp|A1V1A2|PDXH_BURMS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain SAVP1) GN=pdxH PE=3 SV=1 68 284 3.0E-44
sp|Q62M91|PDXH_BURMA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain ATCC 23344) GN=pdxH PE=3 SV=1 68 284 3.0E-44
sp|A2S933|PDXH_BURM9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain NCTC 10229) GN=pdxH PE=3 SV=1 68 284 3.0E-44
sp|A3MHF0|PDXH_BURM7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia mallei (strain NCTC 10247) GN=pdxH PE=3 SV=1 68 284 3.0E-44
sp|B2U826|PDXH_RALPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ralstonia pickettii (strain 12J) GN=pdxH PE=3 SV=1 69 284 2.0E-43
sp|Q474I9|PDXH_CUPPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pdxH PE=3 SV=1 69 284 2.0E-43
sp|A7HR80|PDXH_PARL1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pdxH PE=3 SV=1 83 284 2.0E-43
sp|A5EXX0|PDXH_DICNV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Dichelobacter nodosus (strain VCS1703A) GN=pdxH PE=3 SV=1 74 284 2.0E-43
sp|Q0ARD7|PDXH_MARMM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Maricaulis maris (strain MCS10) GN=pdxH PE=3 SV=1 83 284 4.0E-43
sp|Q8Y1C3|PDXH1_RALSO Pyridoxine/pyridoxamine 5'-phosphate oxidase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=pdxH1 PE=3 SV=1 69 284 4.0E-43
sp|B7LQN2|PDXH_ESCF3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pdxH PE=3 SV=1 68 284 5.0E-43
sp|A5CX08|PDXH_VESOH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=pdxH PE=3 SV=1 68 284 1.0E-42
sp|B8HMK7|PDXH_CYAP4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pdxH PE=3 SV=1 60 284 1.0E-42
sp|A9I847|PDXH_BORPD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pdxH PE=3 SV=1 60 284 1.0E-42
sp|A0K9Z1|PDXH_BURCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain HI2424) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|Q1BU45|PDXH_BURCA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain AU 1054) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|B1JXH8|PDXH_BURCC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain MC0-3) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|P0AFI8|PDXH_SHIFL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella flexneri GN=pdxH PE=3 SV=2 68 284 2.0E-42
sp|Q0T4D9|PDXH_SHIF8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella flexneri serotype 5b (strain 8401) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|Q32FD5|PDXH_SHIDS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|Q320Z5|PDXH_SHIBS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella boydii serotype 4 (strain Sb227) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|B7NB92|PDXH_ECOLU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|P0AFI7|PDXH_ECOLI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12) GN=pdxH PE=1 SV=2 68 284 2.0E-42
sp|B1IQB6|PDXH_ECOLC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|A8A0I1|PDXH_ECOHS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O9:H4 (strain HS) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|B1XFV0|PDXH_ECODH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12 / DH10B) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|C4ZYA1|PDXH_ECOBW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|B7URX9|PDXH_ECO27 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|Q39DH2|PDXH_BURL3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|B1YVG1|PDXH_BURA4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia ambifaria (strain MC40-6) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|B7NTZ4|PDXH_ECO7I Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|Q0BCF1|PDXH_BURCM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pdxH PE=3 SV=1 68 284 2.0E-42
sp|B0JI39|PDXH_MICAN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Microcystis aeruginosa (strain NIES-843) GN=pdxH PE=3 SV=1 69 284 3.0E-42
sp|B1LEP8|PDXH_ECOSM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pdxH PE=3 SV=1 68 284 3.0E-42
sp|Q87FE9|PDXH_VIBPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pdxH PE=3 SV=1 68 284 3.0E-42
sp|Q083L3|PDXH_SHEFN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pdxH PE=3 SV=1 68 284 3.0E-42
sp|Q1QWA6|PDXH_CHRSD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pdxH PE=3 SV=1 73 284 5.0E-42
sp|B5Z472|PDXH_ECO5E Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pdxH PE=3 SV=1 68 284 5.0E-42
sp|Q8X647|PDXH_ECO57 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O157:H7 GN=pdxH PE=3 SV=1 68 284 5.0E-42
sp|A5VNZ1|PDXH_BRUO2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdxH PE=3 SV=1 81 284 5.0E-42
sp|B0CKA2|PDXH_BRUSI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdxH PE=3 SV=1 81 284 5.0E-42
sp|C0RHC3|PDXH_BRUMB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pdxH PE=3 SV=1 81 284 5.0E-42
sp|A9M8J1|PDXH_BRUC2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdxH PE=3 SV=1 81 284 5.0E-42
sp|B2S9Q7|PDXH_BRUA1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella abortus (strain S19) GN=pdxH PE=3 SV=1 81 284 5.0E-42
sp|Q31E41|PDXH2_THICR Pyridoxine/pyridoxamine 5'-phosphate oxidase 2 OS=Thiomicrospira crunogena (strain XCL-2) GN=pdxH2 PE=3 SV=1 74 284 5.0E-42
sp|Q8G2A9|PDXH_BRUSU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella suis biovar 1 (strain 1330) GN=pdxH PE=3 SV=1 81 284 6.0E-42
sp|Q8YFK3|PDXH_BRUME Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdxH PE=3 SV=1 81 284 6.0E-42
sp|Q57EU9|PDXH_BRUAB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella abortus biovar 1 (strain 9-941) GN=pdxH PE=3 SV=1 81 284 6.0E-42
sp|Q2YMD1|PDXH_BRUA2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Brucella abortus (strain 2308) GN=pdxH PE=3 SV=1 81 284 6.0E-42
sp|A6WWA8|PDXH_OCHA4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdxH PE=3 SV=2 83 284 7.0E-42
sp|B4E9I1|PDXH_BURCJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pdxH PE=3 SV=1 68 284 8.0E-42
sp|Q2KVR0|PDXH_BORA1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella avium (strain 197N) GN=pdxH PE=3 SV=1 60 284 8.0E-42
sp|Q7VU72|PDXH_BORPE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pdxH PE=3 SV=1 60 284 9.0E-42
sp|Q7W4Q1|PDXH_BORPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pdxH PE=3 SV=1 60 284 9.0E-42
sp|Q7WG77|PDXH_BORBR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pdxH PE=3 SV=1 60 284 9.0E-42
sp|Q15R35|PDXH_PSEA6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pdxH PE=3 SV=1 68 284 9.0E-42
sp|A0LR32|PDXH_ACIC1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=pdxH PE=3 SV=1 68 284 9.0E-42
sp|Q3Z1Z4|PDXH_SHISS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella sonnei (strain Ss046) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|B2U2D8|PDXH_SHIB3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|B6IB77|PDXH_ECOSE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain SE11) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|B7M0J5|PDXH_ECO8A Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O8 (strain IAI1) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|B7L5J1|PDXH_ECO55 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain 55989 / EAEC) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|Q11KF1|PDXH_CHESB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Chelativorans sp. (strain BNC1) GN=pdxH PE=3 SV=1 83 284 1.0E-41
sp|A8FWJ0|PDXH_SHESH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sediminis (strain HAW-EB3) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|Q1LK07|PDXH_CUPMC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|A7ZMA0|PDXH_ECO24 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pdxH PE=3 SV=1 68 284 1.0E-41
sp|Q1RBF7|PDXH_ECOUT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain UTI89 / UPEC) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|Q8FH87|PDXH_ECOL6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|Q0THJ0|PDXH_ECOL5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|A1ABI3|PDXH_ECOK1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O1:K1 / APEC GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B7MVB6|PDXH_ECO81 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O81 (strain ED1a) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B7M9Z2|PDXH_ECO45 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|Q8ZPM9|PDXH_SALTY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B4TV07|PDXH_SALSV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella schwarzengrund (strain CVM19633) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B5BKC1|PDXH_SALPK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi A (strain AKU_12601) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|C0Q5T4|PDXH_SALPC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi C (strain RKS4594) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|A9N035|PDXH_SALPB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|Q5PIK6|PDXH_SALPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B4T585|PDXH_SALNS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella newport (strain SL254) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B4THC5|PDXH_SALHS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella heidelberg (strain SL476) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B5RAL1|PDXH_SALG2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B5QV11|PDXH_SALEP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella enteritidis PT4 (strain P125109) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B5FIF5|PDXH_SALDC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella dublin (strain CT_02021853) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|Q57PI9|PDXH_SALCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella choleraesuis (strain SC-B67) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|B5F6J9|PDXH_SALA4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella agona (strain SL483) GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|Q8UHC2|PDXH_AGRFC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pdxH PE=3 SV=1 80 284 2.0E-41
sp|Q7MU50|PDXH_PORGI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pdxH PE=3 SV=1 73 284 2.0E-41
sp|Q8Z6Q2|PDXH_SALTI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salmonella typhi GN=pdxH PE=3 SV=1 68 284 2.0E-41
sp|A9AGI1|PDXH_BURM1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=pdxH PE=3 SV=1 68 284 3.0E-41
sp|A3QDE1|PDXH_SHELP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pdxH PE=3 SV=1 68 284 3.0E-41
sp|Q12LW9|PDXH_SHEDO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pdxH PE=3 SV=1 68 284 3.0E-41
sp|C3LWZ1|PDXH_VIBCM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pdxH PE=3 SV=1 68 284 3.0E-41
sp|Q9KKM4|PDXH_VIBCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pdxH PE=3 SV=1 68 284 3.0E-41
sp|B2RHS7|PDXH_PORG3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=pdxH PE=3 SV=1 73 284 3.0E-41
sp|Q0BVM8|PDXH_GRABC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pdxH PE=3 SV=1 83 268 4.0E-41
sp|Q04ZE7|PDXH_LEPBL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=pdxH PE=3 SV=1 67 284 4.0E-41
sp|Q04R37|PDXH_LEPBJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=pdxH PE=3 SV=1 67 284 4.0E-41
sp|A8AH19|PDXH_CITK8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pdxH PE=3 SV=1 68 284 5.0E-41
sp|Q8A7E7|PDXH_BACTN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pdxH PE=3 SV=1 67 284 6.0E-41
sp|Q9LTX3|PPOX1_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic OS=Arabidopsis thaliana GN=PPOX1 PE=1 SV=1 52 284 7.0E-41
sp|A5F176|PDXH_VIBC3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pdxH PE=3 SV=1 68 284 8.0E-41
sp|Q1GVE7|PDXH_SPHAL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pdxH PE=3 SV=1 83 269 9.0E-41
sp|Q2W8Y5|PDXH_MAGSA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pdxH PE=3 SV=2 80 268 9.0E-41
sp|Q7MBT9|PDXH_VIBVY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio vulnificus (strain YJ016) GN=pdxH PE=3 SV=2 68 284 2.0E-40
sp|Q8D510|PDXH_VIBVU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio vulnificus (strain CMCP6) GN=pdxH PE=3 SV=1 68 284 2.0E-40
sp|A7N7P0|PDXH_VIBCB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pdxH PE=3 SV=1 68 284 2.0E-40
sp|A8EV17|PDXH_ARCB4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Arcobacter butzleri (strain RM4018) GN=pdxH PE=3 SV=1 68 284 2.0E-40
sp|A4W9V9|PDXH_ENT38 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Enterobacter sp. (strain 638) GN=pdxH PE=3 SV=1 68 284 3.0E-40
sp|B8EAI0|PDXH_SHEB2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS223) GN=pdxH PE=3 SV=1 68 284 3.0E-40
sp|Q92RH8|PDXH_RHIME Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium meliloti (strain 1021) GN=pdxH PE=3 SV=1 83 284 3.0E-40
sp|A9KY72|PDXH_SHEB9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS195) GN=pdxH PE=3 SV=1 68 284 3.0E-40
sp|A6WM67|PDXH_SHEB8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS185) GN=pdxH PE=3 SV=1 68 284 3.0E-40
sp|A3D3G4|PDXH_SHEB5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pdxH PE=3 SV=1 68 284 3.0E-40
sp|A7MMK2|PDXH_CROS8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pdxH PE=3 SV=1 68 284 5.0E-40
sp|A8GDX9|PDXH_SERP5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Serratia proteamaculans (strain 568) GN=pdxH PE=3 SV=1 68 284 6.0E-40
sp|Q2RR21|PDXH_RHORT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pdxH PE=3 SV=1 83 284 8.0E-40
sp|P44909|PDXH_HAEIN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pdxH PE=3 SV=2 67 284 9.0E-40
sp|Q4QM38|PDXH_HAEI8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Haemophilus influenzae (strain 86-028NP) GN=pdxH PE=3 SV=2 67 284 9.0E-40
sp|B6EQ13|PDXH_ALISL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Aliivibrio salmonicida (strain LFI1238) GN=pdxH PE=3 SV=1 69 284 1.0E-39
sp|A6T9Y6|PDXH_KLEP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pdxH PE=3 SV=2 68 284 1.0E-39
sp|Q6LFS0|PDXH_PHOPR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Photobacterium profundum GN=pdxH PE=3 SV=1 68 284 1.0E-39
sp|A6U6T5|PDXH_SINMW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sinorhizobium medicae (strain WSM419) GN=pdxH PE=3 SV=1 66 284 1.0E-39
sp|A5FWR6|PDXH_ACICJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidiphilium cryptum (strain JF-5) GN=pdxH PE=3 SV=1 79 284 2.0E-39
sp|A4SWL7|PDXH_POLSQ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pdxH PE=3 SV=1 67 284 2.0E-39
sp|A3N3U7|PDXH_ACTP2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pdxH PE=3 SV=1 67 284 2.0E-39
sp|Q64WC2|PDXH_BACFR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bacteroides fragilis (strain YCH46) GN=pdxH PE=3 SV=1 67 284 3.0E-39
sp|Q5LFJ5|PDXH_BACFN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pdxH PE=3 SV=1 67 284 3.0E-39
sp|A1S710|PDXH_SHEAM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pdxH PE=3 SV=1 68 284 3.0E-39
sp|A8HRJ3|PDXH_AZOC5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pdxH PE=3 SV=2 83 284 3.0E-39
sp|Q0HW76|PDXH_SHESR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain MR-7) GN=pdxH PE=3 SV=1 68 284 4.0E-39
sp|B1KRD7|PDXH_SHEWM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pdxH PE=3 SV=1 68 284 4.0E-39
sp|Q66A48|PDXH_YERPS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pdxH PE=3 SV=1 68 284 6.0E-39
sp|Q1CIM4|PDXH_YERPN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pdxH PE=3 SV=2 68 284 6.0E-39
sp|A9QZ96|PDXH_YERPG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pdxH PE=3 SV=1 68 284 6.0E-39
sp|Q8ZE19|PDXH_YERPE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis GN=pdxH PE=3 SV=1 68 284 6.0E-39
sp|Q1C790|PDXH_YERPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pdxH PE=3 SV=2 68 284 6.0E-39
sp|C1D0Z0|PDXH_DEIDV Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pdxH PE=3 SV=1 69 284 6.0E-39
sp|A7FHL9|PDXH_YERP3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pdxH PE=3 SV=1 68 284 6.0E-39
sp|Q3KGY4|PDXH_PSEPF Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pdxH PE=3 SV=1 69 284 6.0E-39
sp|B5EVT2|PDXH_VIBFM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio fischeri (strain MJ11) GN=pdxH PE=3 SV=1 69 284 9.0E-39
sp|Q5DYB5|PDXH_VIBF1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pdxH PE=3 SV=1 69 284 9.0E-39
sp|B3GZF5|PDXH_ACTP7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pdxH PE=3 SV=1 67 284 1.0E-38
sp|Q1J188|PDXH_DEIGD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Deinococcus geothermalis (strain DSM 11300) GN=pdxH PE=3 SV=1 69 284 1.0E-38
sp|Q0HJY0|PDXH_SHESM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain MR-4) GN=pdxH PE=3 SV=1 68 284 1.0E-38
sp|A0KVP0|PDXH_SHESA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain ANA-3) GN=pdxH PE=3 SV=1 68 284 2.0E-38
sp|Q8ED71|PDXH_SHEON Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella oneidensis (strain MR-1) GN=pdxH PE=3 SV=1 68 284 2.0E-38
sp|Q8D2L7|PDXH_WIGBR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Wigglesworthia glossinidia brevipalpis GN=pdxH PE=3 SV=1 68 284 3.0E-38
sp|Q6D5V3|PDXH_PECAS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pdxH PE=3 SV=1 59 284 3.0E-38
sp|A1RKK6|PDXH_SHESW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella sp. (strain W3-18-1) GN=pdxH PE=3 SV=1 68 284 3.0E-38
sp|A6V9E9|PDXH_PSEA7 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain PA7) GN=pdxH PE=3 SV=1 68 284 3.0E-38
sp|A4Y5Z1|PDXH_SHEPC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pdxH PE=3 SV=1 68 284 4.0E-38
sp|Q8DLZ5|PDXH_THEEB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Thermosynechococcus elongatus (strain BP-1) GN=pdxH PE=3 SV=1 83 268 4.0E-38
sp|A5FB76|PDXH_FLAJ1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pdxH PE=3 SV=1 74 283 5.0E-38
sp|A8M0C0|PDXH_SALAI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Salinispora arenicola (strain CNS-205) GN=pdxH PE=3 SV=1 74 284 6.0E-38
sp|B5ZSU2|PDXH_RHILW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pdxH PE=3 SV=1 83 284 8.0E-38
sp|P74211|PDXH_SYNY3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pdxH PE=3 SV=2 69 284 9.0E-38
sp|B0BU37|PDXH_ACTPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pdxH PE=3 SV=1 67 284 1.0E-37
sp|B7VPY4|PDXH_VIBTL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Vibrio tasmaniensis (strain LGP32) GN=pdxH PE=3 SV=1 68 284 1.0E-37
sp|A6VKX9|PDXH_ACTSZ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pdxH PE=3 SV=1 67 284 2.0E-37
sp|A1JNV9|PDXH_YERE8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pdxH PE=3 SV=1 68 284 2.0E-37
sp|B7UXE2|PDXH_PSEA8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain LESB58) GN=pdxH PE=3 SV=1 68 284 2.0E-37
sp|Q8F6Y3|PDXH_LEPIN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=pdxH PE=3 SV=1 69 284 2.0E-37
sp|Q72PF1|PDXH_LEPIC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=pdxH PE=3 SV=1 69 284 2.0E-37
sp|Q2JGW9|PDXH_FRASC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Frankia sp. (strain CcI3) GN=pdxH PE=3 SV=2 48 268 3.0E-37
sp|B9JAN3|PDXH_AGRRK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pdxH PE=3 SV=1 83 284 3.0E-37
sp|A8H5G0|PDXH_SHEPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pdxH PE=3 SV=1 68 284 3.0E-37
sp|B4EWL7|PDXH_PROMH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Proteus mirabilis (strain HI4320) GN=pdxH PE=3 SV=1 68 284 3.0E-37
sp|Q2KBN4|PDXH_RHIEC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pdxH PE=3 SV=1 83 284 3.0E-37
sp|A5VFM5|PDXH_SPHWW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=pdxH PE=3 SV=1 77 268 3.0E-37
sp|Q54YS6|PNPO_DICDI Pyridoxine-5'-phosphate oxidase OS=Dictyostelium discoideum GN=pnpo PE=3 SV=1 69 284 3.0E-37
sp|Q1MKJ4|PDXH_RHIL3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pdxH PE=3 SV=1 83 284 4.0E-37
sp|B3PSA1|PDXH_RHIE6 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium etli (strain CIAT 652) GN=pdxH PE=3 SV=1 83 284 5.0E-37
sp|Q02IL5|PDXH_PSEAB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pdxH PE=3 SV=1 68 284 5.0E-37
sp|B1J1C4|PDXH_PSEPW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain W619) GN=pdxH PE=3 SV=1 69 284 6.0E-37
sp|Q1DCS1|PDXH_MYXXD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Myxococcus xanthus (strain DK 1622) GN=pdxH PE=3 SV=2 74 284 6.0E-37
sp|B2VEN4|PDXH_ERWT9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pdxH PE=3 SV=1 68 284 6.0E-37
sp|C3MHI2|PDXH_RHISN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium sp. (strain NGR234) GN=pdxH PE=3 SV=1 83 284 6.0E-37
sp|P21159|PDXH_MYXXA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Myxococcus xanthus GN=pdxH PE=1 SV=2 74 284 8.0E-37
sp|A0KI46|PDXH_AERHH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pdxH PE=3 SV=2 68 284 9.0E-37
sp|B4RVA4|PDXH_ALTMD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pdxH PE=3 SV=1 68 284 9.0E-37
sp|Q21IG1|PDXH_SACD2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pdxH PE=3 SV=1 81 284 9.0E-37
sp|A4SKR0|PDXH_AERS4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Aeromonas salmonicida (strain A449) GN=pdxH PE=3 SV=2 68 284 9.0E-37
sp|Q8XS03|PDXH2_RALSO Pyridoxine/pyridoxamine 5'-phosphate oxidase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=pdxH2 PE=3 SV=1 83 284 1.0E-36
sp|B9JSN3|PDXH_AGRVS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pdxH PE=3 SV=1 80 284 1.0E-36
sp|Q9I4S5|PDXH_PSEAE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pdxH PE=3 SV=1 68 284 1.0E-36
sp|C3K863|PDXH_PSEFS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas fluorescens (strain SBW25) GN=pdxH PE=3 SV=1 83 284 1.0E-36
sp|A7II77|PDXH_XANP2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pdxH PE=3 SV=1 83 284 3.0E-36
sp|Q83D18|PDXH_COXBU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pdxH PE=3 SV=1 76 284 3.0E-36
sp|Q2GJ82|PDXH_ANAPZ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anaplasma phagocytophilum (strain HZ) GN=pdxH PE=3 SV=1 74 284 3.0E-36
sp|Q07HS0|PDXH_RHOP5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain BisA53) GN=pdxH PE=3 SV=1 83 284 3.0E-36
sp|Q21A86|PDXH_RHOPB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain BisB18) GN=pdxH PE=3 SV=1 83 284 4.0E-36
sp|B0KUA9|PDXH_PSEPG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain GB-1) GN=pdxH PE=3 SV=1 69 284 4.0E-36
sp|A0M2G0|PDXH_GRAFK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Gramella forsetii (strain KT0803) GN=pdxH PE=3 SV=1 69 284 4.0E-36
sp|Q7VP83|PDXH_HAEDU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pdxH PE=3 SV=1 69 284 5.0E-36
sp|Q986A0|PDXH_RHILO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhizobium loti (strain MAFF303099) GN=pdxH PE=3 SV=1 81 284 5.0E-36
sp|Q5ZY37|PDXH_LEGPH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pdxH PE=3 SV=1 74 284 5.0E-36
sp|A5IH19|PDXH_LEGPC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila (strain Corby) GN=pdxH PE=3 SV=1 74 284 5.0E-36
sp|Q5X7K4|PDXH_LEGPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila (strain Paris) GN=pdxH PE=3 SV=1 74 284 5.0E-36
sp|C5BE32|PDXH_EDWI9 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Edwardsiella ictaluri (strain 93-146) GN=pdxH PE=3 SV=1 69 284 6.0E-36
sp|B0TQX6|PDXH_SHEHH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pdxH PE=3 SV=1 68 284 6.0E-36
sp|A4F7G2|PDXH_SACEN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pdxH PE=3 SV=1 69 284 6.0E-36
sp|Q1QC15|PDXH_PSYCK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychrobacter cryohalolentis (strain K5) GN=pdxH PE=3 SV=1 63 284 6.0E-36
sp|Q5WZ02|PDXH_LEGPL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Legionella pneumophila (strain Lens) GN=pdxH PE=3 SV=1 74 284 8.0E-36
sp|B3QIK5|PDXH_RHOPT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain TIE-1) GN=pdxH PE=3 SV=1 82 284 1.0E-35
sp|Q6NAI9|PDXH_RHOPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pdxH PE=3 SV=1 82 284 1.0E-35
sp|Q2NT03|PDXH_SODGM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Sodalis glossinidius (strain morsitans) GN=pdxH PE=3 SV=1 58 284 1.0E-35
sp|Q5FPH2|PDXH_GLUOX Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Gluconobacter oxydans (strain 621H) GN=pdxH PE=3 SV=1 71 284 1.0E-35
sp|A5VZL6|PDXH_PSEP1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pdxH PE=3 SV=1 69 284 1.0E-35
sp|A1SEM4|PDXH_NOCSJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pdxH PE=3 SV=1 67 284 2.0E-35
sp|Q31IR4|PDXH1_THICR Pyridoxine/pyridoxamine 5'-phosphate oxidase 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=pdxH1 PE=3 SV=1 68 284 2.0E-35
sp|Q88NS5|PDXH_PSEPK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain KT2440) GN=pdxH PE=3 SV=1 69 284 2.0E-35
sp|Q5E9K3|PNPO_BOVIN Pyridoxine-5'-phosphate oxidase OS=Bos taurus GN=PNPO PE=2 SV=1 71 284 2.0E-35
sp|Q7P203|PDXH_CHRVO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pdxH PE=3 SV=1 84 284 2.0E-35
sp|A4G883|PDXH_HERAR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Herminiimonas arsenicoxydans GN=pdxH PE=3 SV=1 69 284 2.0E-35
sp|Q2J0U5|PDXH_RHOP2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain HaA2) GN=pdxH PE=3 SV=1 65 284 2.0E-35
sp|Q3SV02|PDXH_NITWN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pdxH PE=3 SV=1 83 284 2.0E-35
sp|Q87XR0|PDXH_PSESM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pdxH PE=3 SV=1 83 284 3.0E-35
sp|Q65QT9|PDXH_MANSM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pdxH PE=3 SV=1 68 284 3.0E-35
sp|B0SPV0|PDXH_LEPBP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=pdxH PE=3 SV=1 83 284 3.0E-35
sp|B0SGE9|PDXH_LEPBA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=pdxH PE=3 SV=1 83 284 3.0E-35
sp|O88794|PNPO_RAT Pyridoxine-5'-phosphate oxidase OS=Rattus norvegicus GN=Pnpo PE=1 SV=1 77 284 3.0E-35
sp|Q3IDP4|PDXH_PSEHT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pdxH PE=3 SV=1 68 284 4.0E-35
sp|Q9A9Q6|PDXH_CAUCR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pdxH PE=3 SV=1 80 284 4.0E-35
sp|B8H292|PDXH_CAUCN Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pdxH PE=3 SV=1 80 284 4.0E-35
sp|A4XS85|PDXH_PSEMY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas mendocina (strain ymp) GN=pdxH PE=3 SV=1 69 284 4.0E-35
sp|Q1QQ51|PDXH_NITHX Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pdxH PE=3 SV=1 68 284 4.0E-35
sp|Q91XF0|PNPO_MOUSE Pyridoxine-5'-phosphate oxidase OS=Mus musculus GN=Pnpo PE=1 SV=1 77 284 4.0E-35
sp|Q11U72|PDXH_CYTH3 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pdxH PE=3 SV=1 67 284 4.0E-35
sp|Q6MK45|PDXH_BDEBA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pdxH PE=3 SV=1 79 284 5.0E-35
sp|Q48LQ7|PDXH_PSE14 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pdxH PE=3 SV=1 83 284 5.0E-35
sp|Q1IDT9|PDXH_PSEE4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas entomophila (strain L48) GN=pdxH PE=3 SV=1 69 284 5.0E-35
sp|B0VNC8|PDXH_ACIBS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain SDF) GN=pdxH PE=3 SV=1 69 284 6.0E-35
sp|A6H098|PDXH_FLAPJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pdxH PE=3 SV=1 63 284 7.0E-35
sp|Q13BJ4|PDXH_RHOPS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodopseudomonas palustris (strain BisB5) GN=pdxH PE=3 SV=1 65 284 8.0E-35
sp|Q9NVS9|PNPO_HUMAN Pyridoxine-5'-phosphate oxidase OS=Homo sapiens GN=PNPO PE=1 SV=1 77 284 9.0E-35
sp|A4VJR0|PDXH_PSEU5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas stutzeri (strain A1501) GN=pdxH PE=3 SV=1 69 284 1.0E-34
sp|Q5QTW7|PDXH_IDILO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pdxH PE=3 SV=1 68 284 1.0E-34
sp|Q4ZPN9|PDXH_PSEU2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pdxH PE=3 SV=1 83 284 2.0E-34
sp|Q4KH71|PDXH_PSEF5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pdxH PE=3 SV=1 69 284 2.0E-34
sp|A1VRL0|PDXH_POLNA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pdxH PE=3 SV=1 61 284 2.0E-34
sp|Q492T8|PDXH_BLOPB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Blochmannia pennsylvanicus (strain BPEN) GN=pdxH PE=3 SV=1 68 284 3.0E-34
sp|B0V9C9|PDXH_ACIBY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain AYE) GN=pdxH PE=3 SV=1 69 284 4.0E-34
sp|A3M9W4|PDXH_ACIBT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pdxH PE=3 SV=2 69 284 4.0E-34
sp|B2I1H7|PDXH_ACIBC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain ACICU) GN=pdxH PE=3 SV=1 69 284 4.0E-34
sp|B7ICC6|PDXH_ACIB5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baumannii (strain AB0057) GN=pdxH PE=3 SV=1 69 284 4.0E-34
sp|Q1LU04|PDXH_BAUCH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pdxH PE=3 SV=1 68 284 6.0E-34
sp|Q6G0E0|PDXH_BARQU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bartonella quintana (strain Toulouse) GN=pdxH PE=3 SV=1 83 268 7.0E-34
sp|A6T1X9|PDXH_JANMA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Janthinobacterium sp. (strain Marseille) GN=pdxH PE=3 SV=1 69 284 7.0E-34
sp|Q2IHV2|PDXH_ANADE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pdxH PE=3 SV=1 114 268 1.0E-33
sp|A4YQ21|PDXH_BRASO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bradyrhizobium sp. (strain ORS278) GN=pdxH PE=3 SV=1 59 284 1.0E-33
sp|A1URW0|PDXH_BARBK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pdxH PE=3 SV=1 82 284 2.0E-33
sp|Q7N3W5|PDXH_PHOLL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pdxH PE=3 SV=1 68 284 2.0E-33
sp|A5EEN4|PDXH_BRASB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pdxH PE=3 SV=1 59 284 2.0E-33
sp|Q47TD1|PDXH_THEFY Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Thermobifida fusca (strain YX) GN=pdxH PE=3 SV=1 62 284 2.0E-33
sp|Q4FS02|PDXH_PSYA2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pdxH PE=3 SV=1 69 284 3.0E-33
sp|B4RM90|PDXH_NEIG2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pdxH PE=3 SV=1 67 284 3.0E-33
sp|Q5F8V2|PDXH_NEIG1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pdxH PE=3 SV=1 67 284 3.0E-33
sp|Q6G4D7|PDXH_BARHE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pdxH PE=3 SV=1 83 268 3.0E-33
sp|Q9RX20|PDXH_DEIRA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pdxH PE=3 SV=1 69 284 3.0E-33
sp|Q126S5|PDXH_POLSJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pdxH PE=3 SV=2 59 284 5.0E-33
sp|Q89RY8|PDXH_BRADU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pdxH PE=3 SV=1 83 284 6.0E-33
sp|A1KUI2|PDXH_NEIMF Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pdxH PE=3 SV=1 67 284 1.0E-32
sp|Q9JTZ1|PDXH_NEIMA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pdxH PE=3 SV=1 67 284 1.0E-32
sp|Q6F718|PDXH_ACIAD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pdxH PE=3 SV=1 69 284 1.0E-32
sp|Q9JYZ5|PDXH_NEIMB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pdxH PE=3 SV=1 67 284 1.0E-32
sp|Q73G09|PDXH_WOLPM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Wolbachia pipientis wMel GN=pdxH PE=3 SV=1 78 284 2.0E-32
sp|A9M007|PDXH_NEIM0 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pdxH PE=3 SV=1 67 284 2.0E-32
sp|Q9RNP3|PDXH_ZYMMO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdxH PE=3 SV=1 83 284 4.0E-32
sp|A5WEW5|PDXH_PSYWF Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Psychrobacter sp. (strain PRwf-1) GN=pdxH PE=3 SV=1 69 284 5.0E-32
sp|Q8P6X5|PDXH_XANCP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pdxH PE=3 SV=1 77 284 6.0E-32
sp|Q4UX84|PDXH_XANC8 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pdxH PE=3 SV=1 77 284 6.0E-32
sp|A2SJZ5|PDXH_METPP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Methylibium petroleiphilum (strain PM1) GN=pdxH PE=3 SV=2 69 284 6.0E-32
sp|Q4FN05|PDXH_PELUB Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pelagibacter ubique (strain HTCC1062) GN=pdxH PE=3 SV=1 83 284 7.0E-32
sp|Q5PBF2|PDXH_ANAMM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Anaplasma marginale (strain St. Maries) GN=pdxH PE=3 SV=2 80 284 1.0E-31
sp|A1W7K9|PDXH_ACISJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidovorax sp. (strain JS42) GN=pdxH PE=3 SV=1 69 284 1.0E-31
sp|Q3YSS1|PDXH_EHRCJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia canis (strain Jake) GN=pdxH PE=3 SV=1 79 284 1.0E-31
sp|Q3BQS3|PDXH_XANC5 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pdxH PE=3 SV=1 77 284 1.0E-31
sp|Q9PDP2|PDXH_XYLFA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xylella fastidiosa (strain 9a5c) GN=pdxH PE=3 SV=1 78 269 2.0E-31
sp|Q0C3Z2|PDXH_HYPNA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Hyphomonas neptunium (strain ATCC 15444) GN=pdxH PE=3 SV=1 59 284 2.0E-31
sp|Q2GCC6|PDXH_NOVAD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pdxH PE=3 SV=1 80 265 2.0E-31
sp|Q2N6B2|PDXH_ERYLH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Erythrobacter litoralis (strain HTCC2594) GN=pdxH PE=3 SV=1 65 268 2.0E-31
sp|C1DEH4|PDXH_AZOVD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pdxH PE=3 SV=1 83 284 3.0E-31
sp|Q2GFR2|PDXH_EHRCR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=pdxH PE=3 SV=1 79 268 3.0E-31
sp|A6WE21|PDXH_KINRD Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pdxH PE=3 SV=1 79 267 3.0E-31
sp|Q8PI89|PDXH_XANAC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pdxH PE=3 SV=1 77 284 3.0E-31
sp|B1XYE2|PDXH_LEPCP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pdxH PE=3 SV=1 67 284 4.0E-31
sp|Q21WR9|PDXH_RHOFT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pdxH PE=3 SV=2 80 284 4.0E-31
sp|A1WL02|PDXH_VEREI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pdxH PE=3 SV=1 74 284 9.0E-31
sp|Q5H3H2|PDXH_XANOR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pdxH PE=3 SV=1 77 284 9.0E-31
sp|Q2P6C7|PDXH_XANOM Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pdxH PE=3 SV=1 77 284 9.0E-31
sp|Q163Z1|PDXH_ROSDO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pdxH PE=3 SV=1 82 284 1.0E-30
sp|A1TQY3|PDXH_ACIAC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Acidovorax citrulli (strain AAC00-1) GN=pdxH PE=3 SV=1 80 284 2.0E-30
sp|Q87DU7|PDXH_XYLFT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pdxH PE=3 SV=1 78 269 2.0E-30
sp|Q5Z236|PDXH_NOCFA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Nocardia farcinica (strain IFM 10152) GN=pdxH PE=3 SV=2 87 267 2.0E-30
sp|Q7VR53|PDXH_BLOFL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Blochmannia floridanus GN=pdxH PE=3 SV=1 74 284 3.0E-30
sp|Q1GHI5|PDXH_RUEST Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ruegeria sp. (strain TM1040) GN=pdxH PE=3 SV=1 88 284 5.0E-30
sp|Q28PH0|PDXH_JANSC Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Jannaschia sp. (strain CCS1) GN=pdxH PE=3 SV=1 83 284 8.0E-30
sp|Q5HBZ2|PDXH_EHRRW Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia ruminantium (strain Welgevonden) GN=pdxH PE=3 SV=1 83 284 8.0E-30
sp|Q5FH81|PDXH_EHRRG Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ehrlichia ruminantium (strain Gardel) GN=pdxH PE=3 SV=1 83 284 8.0E-30
sp|A0R420|PDXH_MYCS2 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pdxH PE=3 SV=1 85 266 1.0E-28
sp|Q20939|PDXH_CAEEL Putative pyridoxamine 5'-phosphate oxidase OS=Caenorhabditis elegans GN=F57B9.1 PE=3 SV=2 82 284 2.0E-28
sp|Q3J3Y3|PDXH_RHOS4 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pdxH PE=3 SV=1 90 284 4.0E-28
sp|A3PIG5|PDXH_RHOS1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pdxH PE=3 SV=1 90 284 6.0E-28
sp|Q5LRI7|PDXH_RUEPO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pdxH PE=3 SV=2 83 284 9.0E-28
sp|A1B0C6|PDXH_PARDP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Paracoccus denitrificans (strain Pd 1222) GN=pdxH PE=3 SV=1 83 284 1.0E-27
sp|A0QBI8|PDXH_MYCA1 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium avium (strain 104) GN=pdxH PE=3 SV=1 87 266 1.0E-27
sp|Q742K7|PDXH_MYCPA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pdxH PE=3 SV=1 87 266 2.0E-27
sp|Q0A757|PDXH_ALKEH Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pdxH PE=3 SV=1 104 284 3.0E-27
sp|Q0VSU8|PDXH_ALCBS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pdxH PE=3 SV=1 67 284 3.0E-27
sp|A3Q628|PDXH_MYCSJ Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium sp. (strain JLS) GN=pdxH PE=3 SV=1 87 266 2.0E-26
sp|O33065|PDXH_MYCLE Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium leprae (strain TN) GN=pdxH PE=3 SV=1 85 266 4.0E-26
sp|Q1B3H2|PDXH_MYCSS Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium sp. (strain MCS) GN=pdxH PE=3 SV=1 87 266 5.0E-26
sp|A1ULM8|PDXH_MYCSK Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium sp. (strain KMS) GN=pdxH PE=3 SV=1 87 266 5.0E-26
sp|A4T792|PDXH_MYCGI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium gilvum (strain PYR-GCK) GN=pdxH PE=3 SV=1 87 266 1.0E-25
sp|A1TF46|PDXH_MYCVP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pdxH PE=3 SV=1 84 266 3.0E-25
sp|P9WIJ1|PDXH_MYCTU Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdxH PE=1 SV=1 67 266 1.0E-24
sp|P9WIJ0|PDXH_MYCTO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdxH PE=3 SV=1 67 266 1.0E-24
sp|A5U5V8|PDXH_MYCTA Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pdxH PE=3 SV=1 67 266 1.0E-24
sp|C1AF78|PDXH_MYCBT Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pdxH PE=3 SV=1 67 266 1.0E-24
sp|A1KLV7|PDXH_MYCBP Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pdxH PE=3 SV=1 67 266 1.0E-24
sp|P65683|PDXH_MYCBO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pdxH PE=3 SV=1 67 266 1.0E-24
sp|Q0S6R1|PDXH_RHOJR Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Rhodococcus jostii (strain RHA1) GN=pdxH PE=3 SV=2 114 284 2.0E-24
sp|A1WXY4|PDXH_HALHL Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pdxH PE=3 SV=1 114 284 8.0E-23
sp|Q51793|PHZG_PSEFL Phenazine biosynthesis protein PhzG OS=Pseudomonas fluorescens GN=phzG PE=1 SV=1 78 284 3.0E-13
sp|Q51521|PHZD_PSECL Phenazine biosynthesis protein PhzD OS=Pseudomonas chlororaphis GN=phzD PE=3 SV=1 81 284 2.0E-10
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2 0.1175 0.0651 0.0633 0.9537 0.2786 0.0359 0.0823 0.0742 0.0634

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4797
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1948
Ophiocordyceps australis map64 (Brazil) OphauB2|3904
Ophiocordyceps camponoti-floridani Ophcf2|03915
Ophiocordyceps kimflemingae Ophio5|6935 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10316

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6935
MRTAAARLSTITSRRLVRCRSAAAVAVGMTRSSGSGSGSGGGSGGGTGGDEVKTGEAKLISPSTQAEQFTLGSLR
RTSLEATPTTQFQNWFATARASTAHAETCVLATSSLPSGHVSARVVYLKEVDADGGFVLYSNWASSRKAADVASN
PNVALVFYWESLQRQVRVEGQALRVSREQSQAYFDTRLRGSRIGAWASRQTSVLEPDDAVQGDDGRLALERAVEE
TESRFDGLQQIPVPDFWGGLRVQPRTVEFWQGRDNRLHDRFLYEWHEPDATWTIKRLSP
Coding >Ophio5|6935
ATGCGTACAGCAGCGGCCCGATTATCCACAATCACCTCTCGTCGTCTGGTTCGCTGCAGGTCGGCGGCTGCGGTT
GCGGTTGGGATGACTCGTAGCAGCGGCAGCGGCAGCGGCAGCGGCGGCGGCAGCGGCGGCGGCACGGGTGGCGAC
GAGGTCAAGACGGGTGAGGCGAAACTCATCTCCCCCTCCACACAAGCGGAACAATTCACGCTGGGAAGCCTAAGA
CGGACGTCGCTTGAAGCGACGCCGACGACGCAATTCCAAAACTGGTTCGCGACGGCGAGGGCGTCGACGGCCCAC
GCGGAAACATGCGTGCTGGCCACAAGCTCGTTACCGTCGGGCCACGTCTCGGCACGGGTCGTGTACCTCAAGGAA
GTCGACGCCGACGGTGGCTTCGTCCTCTACTCCAACTGGGCTTCTTCGCGCAAGGCGGCCGACGTGGCCTCCAAC
CCGAATGTTGCCCTGGTCTTTTATTGGGAGTCGTTGCAGAGGCAGGTTCGTGTCGAGGGTCAGGCTTTGCGTGTC
TCCCGGGAGCAGAGTCAGGCGTATTTCGATACCCGCCTCAGGGGTAGTCGTATCGGTGCTTGGGCCAGTCGCCAG
ACTTCTGTTCTTGAGCCTGACGATGCCGTCCAGGGTGATGATGGGAGGCTTGCGCTGGAGAGGGCCGTGGAGGAG
ACCGAGAGCCGCTTTGACGGTCTTCAACAAATCCCTGTGCCCGACTTTTGGGGCGGGTTGAGGGTTCAGCCCCGG
ACCGTCGAGTTCTGGCAAGGCAGGGATAATCGGTTGCATGATCGCTTTCTCTACGAGTGGCATGAGCCGGACGCC
ACTTGGACCATCAAGCGCTTGAGTCCG
Transcript >Ophio5|6935
ATGCGTACAGCAGCGGCCCGATTATCCACAATCACCTCTCGTCGTCTGGTTCGCTGCAGGTCGGCGGCTGCGGTT
GCGGTTGGGATGACTCGTAGCAGCGGCAGCGGCAGCGGCAGCGGCGGCGGCAGCGGCGGCGGCACGGGTGGCGAC
GAGGTCAAGACGGGTGAGGCGAAACTCATCTCCCCCTCCACACAAGCGGAACAATTCACGCTGGGAAGCCTAAGA
CGGACGTCGCTTGAAGCGACGCCGACGACGCAATTCCAAAACTGGTTCGCGACGGCGAGGGCGTCGACGGCCCAC
GCGGAAACATGCGTGCTGGCCACAAGCTCGTTACCGTCGGGCCACGTCTCGGCACGGGTCGTGTACCTCAAGGAA
GTCGACGCCGACGGTGGCTTCGTCCTCTACTCCAACTGGGCTTCTTCGCGCAAGGCGGCCGACGTGGCCTCCAAC
CCGAATGTTGCCCTGGTCTTTTATTGGGAGTCGTTGCAGAGGCAGGTTCGTGTCGAGGGTCAGGCTTTGCGTGTC
TCCCGGGAGCAGAGTCAGGCGTATTTCGATACCCGCCTCAGGGGTAGTCGTATCGGTGCTTGGGCCAGTCGCCAG
ACTTCTGTTCTTGAGCCTGACGATGCCGTCCAGGGTGATGATGGGAGGCTTGCGCTGGAGAGGGCCGTGGAGGAG
ACCGAGAGCCGCTTTGACGGTCTTCAACAAATCCCTGTGCCCGACTTTTGGGGCGGGTTGAGGGTTCAGCCCCGG
ACCGTCGAGTTCTGGCAAGGCAGGGATAATCGGTTGCATGATCGCTTTCTCTACGAGTGGCATGAGCCGGACGCC
ACTTGGACCATCAAGCGCTTGAGTCCGTGA
Gene >Ophio5|6935
ATGCGTACAGCAGCGGCCCGATTATCCACAATCACCTCTCGTCGTCTGGTTCGCTGCAGGTCGGCGGCTGCGGTT
GCGGTTGGGATGACTCGTAGCAGCGGCAGCGGCAGCGGCAGCGGCGGCGGCAGCGGCGGCGGCACGGGTGGCGAC
GAGGTCAAGACGGGTGAGGCGAAACTCATCTGTGCGTTTCTCCTTTCCTCTCTCTCTCTCTCTCTCTTATGTATA
CACGTCTAGGTCGGAACCAAGATTGAGAATTTTCTTGTTTTCCCCCCTCCCGCTCATTCTTTGACGTGAATGAAA
AAAAAAAAACAAGCATTTTTCTTATTGATTTTTTTTTCTACTTGTTTTTTTGGACGAGGTGGCTAATCCTCGTTC
TAACCCCCCTTTTTTTCAAAAAATCATCACGACAGCCCCCTCCACACAAGCGGAACAATTCACGCTGGGAAGCCT
AAGACGGACGTCGCTTGAAGCGACGCCGACGACGCAATTCCAAAACTGGTTCGCGACGGCGAGGGCGTCGACGGC
CCACGCGGAAACATGCGTGCTGGCCACAAGCTCGTTACCGTCGGGCCACGTCTCGGCACGGGTCGTGTACCTCAA
GGAAGTCGACGCCGACGGTGGCTTCGTCCTCTACTCCAACTGGGCTTCTTCGCGCAAGGCGGCCGACGTGGCCTC
CAACCCGAATGTTGCCCTGGTCTTTTATTGGGAGTCGTTGCAGAGGCAGGTTCGTGTCGAGGGTCAGGCTTTGCG
TGTCTCCCGGGAGCAGAGTCAGGCGTATTTCGATACCCGCCTCAGGGGTAGTCGTATCGGTGCTTGGGCCAGTCG
CCAGACTTCTGTTCTTGAGCCTGACGATGCCGTCCAGGGTGATGATGGGAGGCTTGCGCTGGAGAGGGCCGTGGA
GGAGACCGAGAGCCGCTTTGACGGTCTTCAACAAATCCCTGTGCCCGACTTTTGGGGCGGGTTGAGGGTTCAGCC
CCGGACCGTCGAGTTCTGGCAAGGCAGGGATAATCGGTTGCATGATCGCTTTCTCTACGAGTGGCATGAGCCGGA
CGCCACTTGGACCATCAAGCGCTTGAGTCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail