Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6913
Gene name
Locationscaffold_63:32630..34904
Strand-
Gene length (bp)2274
Transcript length (bp)2274
Coding sequence length (bp)2271
Protein length (aa) 757

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 3.5E-24 37 219
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 7.6E-27 290 476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 32 219 5.0E-14
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 506 606 2.0E-12
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 33 216 4.0E-11
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 33 216 8.0E-11
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 39 216 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 32 219 5.0E-14
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 506 606 2.0E-12
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 33 216 4.0E-11
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 33 216 8.0E-11
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 39 216 2.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 506 603 3.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 506 606 3.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 510 606 5.0E-10
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 39 216 1.0E-09
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 39 216 1.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 506 608 2.0E-09
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 290 481 5.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 506 603 6.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 514 613 1.0E-08
sp|A2R7P5|NST1_ASPNC Stress response protein nst1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nst1 PE=3 SV=1 513 596 1.0E-08
sp|A2R7P5|NST1_ASPNC Stress response protein nst1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nst1 PE=3 SV=1 508 612 4.0E-08
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 291 474 4.0E-08
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 291 474 5.0E-08
sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogaster GN=spen PE=1 SV=2 525 609 1.0E-07
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 508 617 4.0E-07
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 290 481 5.0E-07
sp|C0H5F4|RBP2B_PLAF7 Reticulocyte binding protein 2 homolog b OS=Plasmodium falciparum (isolate 3D7) GN=Rh2b PE=3 SV=1 524 619 6.0E-07
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 290 481 7.0E-07
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 290 474 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6913
MIPERWALAIVVSILPWTNAGRIPTSSIKHPSISLPEFVYRGDGRSPEEIQAAGGFVPWGQPSTSEAYSIFNHEK
GEERNVNSVFVSTSAKFGVARIYASRNNGVVYRIRATPNMIDVEGTMGQHYDGAIEAEFAAMGGIRWDQVHSYWK
ASETSSFGDTDEFGSLDNADYELISSQFEANGRYNVEKYGQSVASAGQPQLAGFHQNHPALNQEPWSTIDQTVST
HDYAKRFALSIGAPDGWLEQYPLFAATNLPQEISDKTAEGPPPLPAKKGKGKPMLEHSKESPQYVFRGSSISPER
MREEGFIPPSRDYTPAAFSLTNHLNKVTNHETKMQDTVYVSTTKVFGVAGGSAKAGNWVYQIHVSPNMIGVQDSL
GKYCDEALKAEFLALGGIRWSQVKGWVHLPDDYIPPGERQELTLNEGFDTLEKSPAYTLNPEYDAEFEKFTASSG
APQLAGFAVGHPALREKPWADSNPALGKSTKDYAMEFMQSIGAPQGWTDKFPMFGEDREMAEMEEKRRQEREEQE
KEKKDREQREKEKKEREEKERKEREEKERKEREEKERKEREEKERKEREEEEKKEREKKAREERERQAAEAKEAA
VRKAKELSSNHPEDSWLGKAFAGLAVGIASTGGGAILTSAAAGSAGQAAAIGPGILTSSEAISVSAAETQALIED
TIAEIIANLPSPPKGPIGTGPALEPALRKRASSTSRAVKTSQSGQTDDERGRRLRVIRLALRSITMDATWQGFYD
ACKKISA
Coding >Ophio5|6913
ATGATTCCTGAACGTTGGGCTCTGGCAATCGTTGTCAGCATACTCCCTTGGACAAACGCTGGCCGCATTCCCACA
TCATCTATCAAGCATCCATCGATTTCCCTCCCAGAATTTGTTTATCGTGGGGATGGCAGGAGCCCGGAGGAGATT
CAGGCAGCGGGAGGGTTCGTGCCATGGGGACAACCTTCGACTTCCGAGGCATACAGCATCTTCAACCACGAAAAG
GGCGAAGAAAGAAATGTCAACAGCGTATTTGTCTCAACTTCGGCCAAATTTGGAGTCGCGAGGATTTACGCATCT
AGAAATAATGGTGTCGTCTACCGAATACGGGCTACGCCAAACATGATCGATGTCGAGGGGACCATGGGTCAACAT
TATGATGGCGCGATAGAAGCGGAATTCGCAGCCATGGGAGGTATCAGATGGGACCAAGTGCACAGTTACTGGAAA
GCTTCTGAAACGTCATCATTCGGCGATACTGACGAGTTTGGGTCTCTCGACAACGCCGACTATGAGCTAATATCC
AGCCAATTTGAAGCGAATGGTCGGTACAACGTGGAAAAGTATGGACAAAGTGTTGCCAGTGCTGGACAGCCTCAA
TTGGCTGGCTTCCACCAGAATCATCCAGCTCTAAACCAAGAACCCTGGAGCACTATCGACCAGACAGTATCGACA
CATGACTACGCCAAGCGGTTTGCACTCAGCATAGGGGCACCCGATGGATGGCTCGAACAGTATCCATTGTTTGCC
GCTACGAATCTGCCACAAGAGATATCCGATAAGACTGCGGAAGGCCCTCCACCACTGCCAGCCAAAAAAGGAAAG
GGGAAGCCGATGCTCGAGCATTCAAAAGAATCACCTCAATACGTTTTCCGAGGCAGTAGTATCAGCCCAGAGAGG
ATGAGGGAAGAGGGGTTTATACCGCCTTCGCGGGATTACACACCTGCGGCATTTTCACTCACTAACCATCTGAAC
AAAGTCACCAACCACGAGACAAAAATGCAAGATACTGTTTACGTCTCAACAACGAAGGTGTTTGGGGTTGCAGGA
GGCTCTGCTAAAGCAGGCAATTGGGTCTACCAGATTCACGTCTCGCCGAATATGATTGGCGTGCAAGACTCCCTT
GGCAAATACTGCGACGAGGCGTTGAAGGCGGAGTTCTTAGCTCTAGGGGGGATACGCTGGTCTCAGGTCAAAGGC
TGGGTCCATCTGCCAGACGACTATATCCCCCCGGGTGAACGGCAGGAGCTTACCTTGAACGAGGGCTTTGACACC
TTGGAGAAGTCACCTGCATACACGCTGAATCCAGAATACGATGCAGAATTTGAAAAATTCACCGCCAGTAGTGGA
GCACCACAGCTGGCTGGCTTCGCAGTAGGGCATCCGGCCTTGAGGGAAAAGCCTTGGGCCGACTCGAATCCGGCA
CTCGGGAAGTCAACCAAGGATTATGCCATGGAGTTTATGCAGTCTATCGGGGCACCTCAGGGCTGGACGGATAAG
TTTCCCATGTTTGGGGAAGACAGGGAGATGGCGGAAATGGAGGAAAAGAGACGGCAGGAGAGAGAAGAGCAGGAG
AAAGAGAAAAAGGACAGAGAACAAAGAGAAAAGGAGAAAAAAGAGAGGGAGGAAAAGGAGAGAAAAGAGAGGGAG
GAAAAAGAGAGAAAAGAGAGGGAGGAAAAAGAGAGAAAAGAGAGGGAGGAAAAAGAGAGAAAAGAGAGGGAGGAA
GAAGAAAAGAAAGAAAGGGAGAAGAAAGCGAGGGAAGAAAGGGAAAGACAAGCAGCTGAGGCCAAAGAGGCTGCC
GTTCGCAAAGCAAAAGAGCTGTCATCGAATCATCCCGAAGACTCCTGGTTGGGAAAGGCCTTTGCAGGCCTTGCC
GTGGGAATCGCTTCAACTGGAGGCGGAGCAATCTTGACGTCTGCCGCCGCAGGATCAGCTGGGCAAGCCGCGGCG
ATTGGGCCGGGCATCCTGACAAGCTCAGAGGCAATATCCGTCTCCGCAGCCGAAACACAGGCATTAATCGAGGAC
ACAATCGCGGAAATTATTGCGAACCTGCCGTCGCCGCCCAAAGGACCGATAGGAACAGGGCCAGCCTTGGAGCCT
GCGCTGCGGAAACGAGCCTCTTCTACTTCAAGGGCCGTGAAGACAAGTCAAAGCGGCCAGACAGACGACGAAAGA
GGACGGAGACTCCGTGTTATAAGGTTGGCGCTGCGGTCGATCACTATGGACGCTACTTGGCAGGGTTTCTATGAC
GCTTGCAAGAAGATCTCGGCC
Transcript >Ophio5|6913
ATGATTCCTGAACGTTGGGCTCTGGCAATCGTTGTCAGCATACTCCCTTGGACAAACGCTGGCCGCATTCCCACA
TCATCTATCAAGCATCCATCGATTTCCCTCCCAGAATTTGTTTATCGTGGGGATGGCAGGAGCCCGGAGGAGATT
CAGGCAGCGGGAGGGTTCGTGCCATGGGGACAACCTTCGACTTCCGAGGCATACAGCATCTTCAACCACGAAAAG
GGCGAAGAAAGAAATGTCAACAGCGTATTTGTCTCAACTTCGGCCAAATTTGGAGTCGCGAGGATTTACGCATCT
AGAAATAATGGTGTCGTCTACCGAATACGGGCTACGCCAAACATGATCGATGTCGAGGGGACCATGGGTCAACAT
TATGATGGCGCGATAGAAGCGGAATTCGCAGCCATGGGAGGTATCAGATGGGACCAAGTGCACAGTTACTGGAAA
GCTTCTGAAACGTCATCATTCGGCGATACTGACGAGTTTGGGTCTCTCGACAACGCCGACTATGAGCTAATATCC
AGCCAATTTGAAGCGAATGGTCGGTACAACGTGGAAAAGTATGGACAAAGTGTTGCCAGTGCTGGACAGCCTCAA
TTGGCTGGCTTCCACCAGAATCATCCAGCTCTAAACCAAGAACCCTGGAGCACTATCGACCAGACAGTATCGACA
CATGACTACGCCAAGCGGTTTGCACTCAGCATAGGGGCACCCGATGGATGGCTCGAACAGTATCCATTGTTTGCC
GCTACGAATCTGCCACAAGAGATATCCGATAAGACTGCGGAAGGCCCTCCACCACTGCCAGCCAAAAAAGGAAAG
GGGAAGCCGATGCTCGAGCATTCAAAAGAATCACCTCAATACGTTTTCCGAGGCAGTAGTATCAGCCCAGAGAGG
ATGAGGGAAGAGGGGTTTATACCGCCTTCGCGGGATTACACACCTGCGGCATTTTCACTCACTAACCATCTGAAC
AAAGTCACCAACCACGAGACAAAAATGCAAGATACTGTTTACGTCTCAACAACGAAGGTGTTTGGGGTTGCAGGA
GGCTCTGCTAAAGCAGGCAATTGGGTCTACCAGATTCACGTCTCGCCGAATATGATTGGCGTGCAAGACTCCCTT
GGCAAATACTGCGACGAGGCGTTGAAGGCGGAGTTCTTAGCTCTAGGGGGGATACGCTGGTCTCAGGTCAAAGGC
TGGGTCCATCTGCCAGACGACTATATCCCCCCGGGTGAACGGCAGGAGCTTACCTTGAACGAGGGCTTTGACACC
TTGGAGAAGTCACCTGCATACACGCTGAATCCAGAATACGATGCAGAATTTGAAAAATTCACCGCCAGTAGTGGA
GCACCACAGCTGGCTGGCTTCGCAGTAGGGCATCCGGCCTTGAGGGAAAAGCCTTGGGCCGACTCGAATCCGGCA
CTCGGGAAGTCAACCAAGGATTATGCCATGGAGTTTATGCAGTCTATCGGGGCACCTCAGGGCTGGACGGATAAG
TTTCCCATGTTTGGGGAAGACAGGGAGATGGCGGAAATGGAGGAAAAGAGACGGCAGGAGAGAGAAGAGCAGGAG
AAAGAGAAAAAGGACAGAGAACAAAGAGAAAAGGAGAAAAAAGAGAGGGAGGAAAAGGAGAGAAAAGAGAGGGAG
GAAAAAGAGAGAAAAGAGAGGGAGGAAAAAGAGAGAAAAGAGAGGGAGGAAAAAGAGAGAAAAGAGAGGGAGGAA
GAAGAAAAGAAAGAAAGGGAGAAGAAAGCGAGGGAAGAAAGGGAAAGACAAGCAGCTGAGGCCAAAGAGGCTGCC
GTTCGCAAAGCAAAAGAGCTGTCATCGAATCATCCCGAAGACTCCTGGTTGGGAAAGGCCTTTGCAGGCCTTGCC
GTGGGAATCGCTTCAACTGGAGGCGGAGCAATCTTGACGTCTGCCGCCGCAGGATCAGCTGGGCAAGCCGCGGCG
ATTGGGCCGGGCATCCTGACAAGCTCAGAGGCAATATCCGTCTCCGCAGCCGAAACACAGGCATTAATCGAGGAC
ACAATCGCGGAAATTATTGCGAACCTGCCGTCGCCGCCCAAAGGACCGATAGGAACAGGGCCAGCCTTGGAGCCT
GCGCTGCGGAAACGAGCCTCTTCTACTTCAAGGGCCGTGAAGACAAGTCAAAGCGGCCAGACAGACGACGAAAGA
GGACGGAGACTCCGTGTTATAAGGTTGGCGCTGCGGTCGATCACTATGGACGCTACTTGGCAGGGTTTCTATGAC
GCTTGCAAGAAGATCTCGGCCTAG
Gene >Ophio5|6913
ATGATTCCTGAACGTTGGGCTCTGGCAATCGTTGTCAGCATACTCCCTTGGACAAACGCTGGCCGCATTCCCACA
TCATCTATCAAGCATCCATCGATTTCCCTCCCAGAATTTGTTTATCGTGGGGATGGCAGGAGCCCGGAGGAGATT
CAGGCAGCGGGAGGGTTCGTGCCATGGGGACAACCTTCGACTTCCGAGGCATACAGCATCTTCAACCACGAAAAG
GGCGAAGAAAGAAATGTCAACAGCGTATTTGTCTCAACTTCGGCCAAATTTGGAGTCGCGAGGATTTACGCATCT
AGAAATAATGGTGTCGTCTACCGAATACGGGCTACGCCAAACATGATCGATGTCGAGGGGACCATGGGTCAACAT
TATGATGGCGCGATAGAAGCGGAATTCGCAGCCATGGGAGGTATCAGATGGGACCAAGTGCACAGTTACTGGAAA
GCTTCTGAAACGTCATCATTCGGCGATACTGACGAGTTTGGGTCTCTCGACAACGCCGACTATGAGCTAATATCC
AGCCAATTTGAAGCGAATGGTCGGTACAACGTGGAAAAGTATGGACAAAGTGTTGCCAGTGCTGGACAGCCTCAA
TTGGCTGGCTTCCACCAGAATCATCCAGCTCTAAACCAAGAACCCTGGAGCACTATCGACCAGACAGTATCGACA
CATGACTACGCCAAGCGGTTTGCACTCAGCATAGGGGCACCCGATGGATGGCTCGAACAGTATCCATTGTTTGCC
GCTACGAATCTGCCACAAGAGATATCCGATAAGACTGCGGAAGGCCCTCCACCACTGCCAGCCAAAAAAGGAAAG
GGGAAGCCGATGCTCGAGCATTCAAAAGAATCACCTCAATACGTTTTCCGAGGCAGTAGTATCAGCCCAGAGAGG
ATGAGGGAAGAGGGGTTTATACCGCCTTCGCGGGATTACACACCTGCGGCATTTTCACTCACTAACCATCTGAAC
AAAGTCACCAACCACGAGACAAAAATGCAAGATACTGTTTACGTCTCAACAACGAAGGTGTTTGGGGTTGCAGGA
GGCTCTGCTAAAGCAGGCAATTGGGTCTACCAGATTCACGTCTCGCCGAATATGATTGGCGTGCAAGACTCCCTT
GGCAAATACTGCGACGAGGCGTTGAAGGCGGAGTTCTTAGCTCTAGGGGGGATACGCTGGTCTCAGGTCAAAGGC
TGGGTCCATCTGCCAGACGACTATATCCCCCCGGGTGAACGGCAGGAGCTTACCTTGAACGAGGGCTTTGACACC
TTGGAGAAGTCACCTGCATACACGCTGAATCCAGAATACGATGCAGAATTTGAAAAATTCACCGCCAGTAGTGGA
GCACCACAGCTGGCTGGCTTCGCAGTAGGGCATCCGGCCTTGAGGGAAAAGCCTTGGGCCGACTCGAATCCGGCA
CTCGGGAAGTCAACCAAGGATTATGCCATGGAGTTTATGCAGTCTATCGGGGCACCTCAGGGCTGGACGGATAAG
TTTCCCATGTTTGGGGAAGACAGGGAGATGGCGGAAATGGAGGAAAAGAGACGGCAGGAGAGAGAAGAGCAGGAG
AAAGAGAAAAAGGACAGAGAACAAAGAGAAAAGGAGAAAAAAGAGAGGGAGGAAAAGGAGAGAAAAGAGAGGGAG
GAAAAAGAGAGAAAAGAGAGGGAGGAAAAAGAGAGAAAAGAGAGGGAGGAAAAAGAGAGAAAAGAGAGGGAGGAA
GAAGAAAAGAAAGAAAGGGAGAAGAAAGCGAGGGAAGAAAGGGAAAGACAAGCAGCTGAGGCCAAAGAGGCTGCC
GTTCGCAAAGCAAAAGAGCTGTCATCGAATCATCCCGAAGACTCCTGGTTGGGAAAGGCCTTTGCAGGCCTTGCC
GTGGGAATCGCTTCAACTGGAGGCGGAGCAATCTTGACGTCTGCCGCCGCAGGATCAGCTGGGCAAGCCGCGGCG
ATTGGGCCGGGCATCCTGACAAGCTCAGAGGCAATATCCGTCTCCGCAGCCGAAACACAGGCATTAATCGAGGAC
ACAATCGCGGAAATTATTGCGAACCTGCCGTCGCCGCCCAAAGGACCGATAGGAACAGGGCCAGCCTTGGAGCCT
GCGCTGCGGAAACGAGCCTCTTCTACTTCAAGGGCCGTGAAGACAAGTCAAAGCGGCCAGACAGACGACGAAAGA
GGACGGAGACTCCGTGTTATAAGGTTGGCGCTGCGGTCGATCACTATGGACGCTACTTGGCAGGGTTTCTATGAC
GCTTGCAAGAAGATCTCGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail