Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6912
Gene name
Locationscaffold_63:30749..31988
Strand+
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88 4.3E-32 141 398

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34559|URHG2_BACSU Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) GN=yteR PE=1 SV=1 146 398 2.0E-24
sp|P0A3U7|PIC1_RHIRD 24.9 kDa protein in picA locus OS=Rhizobium radiobacter PE=2 SV=1 205 308 4.0E-08
sp|P0A3U6|PIC1_AGRFC Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu3128 PE=3 SV=1 205 308 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6912
MLLQTTTLLAVSVAAAATATTTTTTTTTPFSRLMLDSLKTRLQGIASSGAPSSTLESAVLALSIEALLDQYPASG
PGPDNDDLFLGAVLDLAAGAFPDADRAADRPMDRFALATAIDRAISSGRVPVSPAARNASRAIAASLPLQTRNPD
GGLWYYHAYPQWSYLDGLFAVLPYLAALPGRNESDMELQLALVQKHCDRPAGRPLLVHGYDWSRTASWADAKNGA
SPHVWGRSMGWLLVGVIETWEMLSCAGHHSRPFCHRLQRLTLRVADSLVSLADLESGAWRQLTILSEHFGNYLES
SSTALYIFALLKALRIRMLPPGPPYYRHVAERAYNYTLHSFVNYDPKNSSIIGYGRTVSVCSLNSSASYEYYISQ
PLMPNSLLGESAFILASLEIERLEPEPDGLTIPFSNK
Coding >Ophio5|6912
ATGCTTCTCCAAACGACGACGCTCCTCGCCGTGAGCGTCGCCGCGGCGGCGACGGCGACGACGACGACGACGACG
ACGACGACCCCCTTTTCAAGACTGATGCTCGACAGTCTCAAGACGCGACTTCAGGGCATCGCCTCATCCGGCGCC
CCATCCAGCACGCTCGAAAGCGCCGTGCTGGCCCTCTCCATCGAGGCCTTATTGGATCAGTATCCCGCATCCGGC
CCCGGCCCCGACAACGACGACCTCTTTCTCGGCGCCGTGCTCGACCTCGCTGCCGGGGCTTTTCCGGATGCGGAT
CGGGCCGCAGACCGGCCGATGGACCGCTTCGCACTCGCCACGGCCATCGACAGGGCTATCAGCTCCGGCCGCGTC
CCCGTCTCTCCGGCCGCTCGGAATGCCTCGCGCGCCATTGCCGCTTCGCTACCGCTTCAGACGCGCAACCCGGAC
GGCGGCCTGTGGTACTATCACGCCTATCCTCAGTGGTCCTATCTCGACGGCCTCTTCGCTGTGCTGCCTTACCTA
GCTGCCTTACCAGGCCGCAACGAGAGCGACATGGAGTTGCAGCTTGCTCTCGTTCAGAAGCACTGTGACAGGCCG
GCTGGTCGTCCGCTGCTGGTTCACGGCTACGACTGGTCGCGGACCGCCTCTTGGGCCGATGCCAAGAACGGCGCG
AGCCCGCATGTTTGGGGCCGGTCCATGGGCTGGCTGCTTGTAGGCGTCATCGAGACGTGGGAGATGCTGAGCTGC
GCCGGACATCATTCTCGACCGTTCTGTCACCGCCTGCAGCGCCTTACTCTCCGCGTCGCCGACTCGCTCGTCAGT
CTCGCCGATCTCGAATCCGGAGCCTGGCGGCAACTTACCATCCTATCGGAACACTTTGGCAATTATCTCGAGAGC
TCGAGCACGGCGCTCTACATATTTGCTTTGCTGAAAGCTCTTCGCATCCGCATGCTCCCGCCCGGTCCTCCCTAC
TATCGACATGTAGCCGAGCGTGCCTACAACTACACCCTTCACTCCTTTGTGAATTATGATCCCAAGAACAGCAGC
ATTATCGGCTACGGCCGGACCGTCTCAGTTTGCAGTCTCAACTCAAGTGCCTCCTACGAGTATTACATCTCGCAG
CCCCTTATGCCGAATAGCCTGCTTGGCGAGTCAGCCTTTATCCTGGCCTCTCTAGAGATTGAGAGACTCGAGCCT
GAACCAGACGGGTTGACGATTCCGTTCTCGAATAAG
Transcript >Ophio5|6912
ATGCTTCTCCAAACGACGACGCTCCTCGCCGTGAGCGTCGCCGCGGCGGCGACGGCGACGACGACGACGACGACG
ACGACGACCCCCTTTTCAAGACTGATGCTCGACAGTCTCAAGACGCGACTTCAGGGCATCGCCTCATCCGGCGCC
CCATCCAGCACGCTCGAAAGCGCCGTGCTGGCCCTCTCCATCGAGGCCTTATTGGATCAGTATCCCGCATCCGGC
CCCGGCCCCGACAACGACGACCTCTTTCTCGGCGCCGTGCTCGACCTCGCTGCCGGGGCTTTTCCGGATGCGGAT
CGGGCCGCAGACCGGCCGATGGACCGCTTCGCACTCGCCACGGCCATCGACAGGGCTATCAGCTCCGGCCGCGTC
CCCGTCTCTCCGGCCGCTCGGAATGCCTCGCGCGCCATTGCCGCTTCGCTACCGCTTCAGACGCGCAACCCGGAC
GGCGGCCTGTGGTACTATCACGCCTATCCTCAGTGGTCCTATCTCGACGGCCTCTTCGCTGTGCTGCCTTACCTA
GCTGCCTTACCAGGCCGCAACGAGAGCGACATGGAGTTGCAGCTTGCTCTCGTTCAGAAGCACTGTGACAGGCCG
GCTGGTCGTCCGCTGCTGGTTCACGGCTACGACTGGTCGCGGACCGCCTCTTGGGCCGATGCCAAGAACGGCGCG
AGCCCGCATGTTTGGGGCCGGTCCATGGGCTGGCTGCTTGTAGGCGTCATCGAGACGTGGGAGATGCTGAGCTGC
GCCGGACATCATTCTCGACCGTTCTGTCACCGCCTGCAGCGCCTTACTCTCCGCGTCGCCGACTCGCTCGTCAGT
CTCGCCGATCTCGAATCCGGAGCCTGGCGGCAACTTACCATCCTATCGGAACACTTTGGCAATTATCTCGAGAGC
TCGAGCACGGCGCTCTACATATTTGCTTTGCTGAAAGCTCTTCGCATCCGCATGCTCCCGCCCGGTCCTCCCTAC
TATCGACATGTAGCCGAGCGTGCCTACAACTACACCCTTCACTCCTTTGTGAATTATGATCCCAAGAACAGCAGC
ATTATCGGCTACGGCCGGACCGTCTCAGTTTGCAGTCTCAACTCAAGTGCCTCCTACGAGTATTACATCTCGCAG
CCCCTTATGCCGAATAGCCTGCTTGGCGAGTCAGCCTTTATCCTGGCCTCTCTAGAGATTGAGAGACTCGAGCCT
GAACCAGACGGGTTGACGATTCCGTTCTCGAATAAGTGA
Gene >Ophio5|6912
ATGCTTCTCCAAACGACGACGCTCCTCGCCGTGAGCGTCGCCGCGGCGGCGACGGCGACGACGACGACGACGACG
ACGACGACCCCCTTTTCAAGACTGATGCTCGACAGTCTCAAGACGCGACTTCAGGGCATCGCCTCATCCGGCGCC
CCATCCAGCACGCTCGAAAGCGCCGTGCTGGCCCTCTCCATCGAGGCCTTATTGGATCAGTATCCCGCATCCGGC
CCCGGCCCCGACAACGACGACCTCTTTCTCGGCGCCGTGCTCGACCTCGCTGCCGGGGCTTTTCCGGATGCGGAT
CGGGCCGCAGACCGGCCGATGGACCGCTTCGCACTCGCCACGGCCATCGACAGGGCTATCAGCTCCGGCCGCGTC
CCCGTCTCTCCGGCCGCTCGGAATGCCTCGCGCGCCATTGCCGCTTCGCTACCGCTTCAGACGCGCAACCCGGAC
GGCGGCCTGTGGTACTATCACGCCTATCCTCAGTGGTCCTATCTCGACGGCCTCTTCGCTGTGCTGCCTTACCTA
GCTGCCTTACCAGGCCGCAACGAGAGCGACATGGAGTTGCAGCTTGCTCTCGTTCAGAAGCACTGTGACAGGCCG
GCTGGTCGTCCGCTGCTGGTTCACGGCTACGACTGGTCGCGGACCGCCTCTTGGGCCGATGCCAAGAACGGCGCG
AGCCCGCATGTTTGGGGCCGGTCCATGGGCTGGCTGCTTGTAGGCGTCATCGAGACGTGGGAGATGCTGAGCTGC
GCCGGACATCATTCTCGACCGTTCTGTCACCGCCTGCAGCGCCTTACTCTCCGCGTCGCCGACTCGCTCGTCAGT
CTCGCCGATCTCGAATCCGGAGCCTGGCGGCAACTTACCATCCTATCGGAACACTTTGGCAATTATCTCGAGAGC
TCGAGCACGGCGCTCTACATATTTGCTTTGCTGAAAGCTCTTCGCATCCGCATGCTCCCGCCCGGTCCTCCCTAC
TATCGACATGTAGCCGAGCGTGCCTACAACTACACCCTTCACTCCTTTGTGAATTATGATCCCAAGAACAGCAGC
ATTATCGGCTACGGCCGGACCGTCTCAGTTTGCAGTCTCAACTCAAGTGCCTCCTACGAGTATTACATCTCGCAG
CCCCTTATGCCGAATAGCCTGCTTGGCGAGTCAGCCTTTATCCTGGCCTCTCTAGAGATTGAGAGACTCGAGCCT
GAACCAGACGGGTTGACGATTCCGTTCTCGAATAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail