Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6908
Gene name
Locationscaffold_63:20074..20419
Strand+
Gene length (bp)345
Transcript length (bp)225
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0678 0.054 0.9483 0.0569 0.0686 0.0038 0.042 0.1138 0.0495 0.0034

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999758

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup507
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7417
Ophiocordyceps australis map64 (Brazil) OphauB2|7158
Ophiocordyceps camponoti-floridani Ophcf2|01050
Ophiocordyceps camponoti-floridani Ophcf2|02384
Ophiocordyceps kimflemingae Ophio5|6908 (this protein)
Ophiocordyceps subramaniannii Hirsu2|185
Ophiocordyceps subramaniannii Hirsu2|5775
Ophiocordyceps subramaniannii Hirsu2|6831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6908
MKTFATTILLLCVAGAMAADCRDGLWYCGHTLRRIGDYQSRIDQAFVGMGLDGTRDGFHDLFVCLGRGANDFCL
Coding >Ophio5|6908
ATGAAAACGTTCGCAACTACCATCCTTCTCCTCTGCGTCGCTGGCGCCATGGCTGCCGATTGTAGAGATGGCCTT
TGGTACTGTGGACATACGCTCCGCCGAATCGGCGACTATCAGTCTCGCATCGACCAAGCTTTCGTGGGTATGGGT
TTGGATGGTACTAGAGATGGTTTCCATGATTTGTTTGTGTGTCTCGGACGTGGCGCCAACGACTTCTGCCTT
Transcript >Ophio5|6908
ATGAAAACGTTCGCAACTACCATCCTTCTCCTCTGCGTCGCTGGCGCCATGGCTGCCGATTGTAGAGATGGCCTT
TGGTACTGTGGACATACGCTCCGCCGAATCGGCGACTATCAGTCTCGCATCGACCAAGCTTTCGTGGGTATGGGT
TTGGATGGTACTAGAGATGGTTTCCATGATTTGTTTGTGTGTCTCGGACGTGGCGCCAACGACTTCTGCCTTTGA
Gene >Ophio5|6908
ATGAAAACGTTCGCAACTACCATCCTTCTCCTCTGCGTCGCTGGCGCCATGGCTGCCGATTGTAGAGATGGCCTT
TGGTACTGTGGACATACGCTCCGCCGAATCGGTGAGCAAGCTGGCTAGTACTAAGCGTCGAGCTCGGAAACTAAA
GGCAACCCATTCATCTACCTAGGCGACTATCAGTCTCGCATCGACCAAGCTTTCGTGGGTATGGGTTTGGATGGT
ACTAGAGATGGTTTCCATGATTTGTTTGTGTGTCTCGGACGTGGCGCCGTGAGTCACCTCATGCCTTGTCCTAAA
GGCTGCTATAATTCCGGATCCCTACAGAACGACTTCTGCCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail