Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6902
Gene name
Locationscaffold_629:8966..10996
Strand+
Gene length (bp)2030
Transcript length (bp)1824
Coding sequence length (bp)1821
Protein length (aa) 607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 5.1E-08 142 245
PF00651 BTB BTB/POZ domain 1.2E-11 344 429
PF13637 Ank_4 Ankyrin repeats (many copies) 5.9E-07 42 88
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.9E-07 41 92
PF00023 Ank Ankyrin repeat 6.3E-03 69 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb3 PE=1 SV=1 7 547 6.0E-83
sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL001W PE=1 SV=1 36 541 4.0E-63
sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1 34 531 1.0E-41
sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1 34 531 6.0E-41
sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=ABTB1 PE=1 SV=1 34 531 6.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb3 PE=1 SV=1 7 547 6.0E-83
sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL001W PE=1 SV=1 36 541 4.0E-63
sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1 34 531 1.0E-41
sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1 34 531 6.0E-41
sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=ABTB1 PE=1 SV=1 34 531 6.0E-39
sp|Q9SJ85|Y2474_ARATH BTB/POZ domain-containing protein At2g04740 OS=Arabidopsis thaliana GN=At2g04740 PE=2 SV=2 37 399 6.0E-18
sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 7 110 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6154 0.6753 0.0396 0.0423 0.0533 0.0126 0.2801 0.2917 0.2389 0.0077

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2902
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6474
Ophiocordyceps australis map64 (Brazil) OphauB2|855
Ophiocordyceps camponoti-floridani Ophcf2|03819
Ophiocordyceps camponoti-rufipedis Ophun1|1159
Ophiocordyceps kimflemingae Ophio5|6902 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4843

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6902
MVLPKHELEGKLGEERLMIKSGLLRDENPLDQTLEFNDFLLACRRGDLRRCQELINQGVNINGKDKFDYTPLIIA
SLCGHYELVQLLLDSGALAERNTFQGERCIYNALNDRIRNLLLRYDFSKSADPYVYWSTHLTTLLSRDKPATSDL
RLVSGPRSFRLHRFLLVARTPYFRSRLEAQPETTSWNLNPAVPSEAVHIALRYLYLDQLPADLVPPDRSNSVSED
DVAKGLIKISKQLGVERLWDAVVACSDRRLVRQRYRDEEERAVEEIGDFFRLRVLGGKMVVDTDRVSDVRLRLDN
AAFADVLLRADEPSVNSDEDAASSPPLLNSQGIPLGPRPSKSVLFPCHKAMLIRSEYFAIMFSGDFIEAQESPHL
RVITVDCTPAVLELVLTYLYTDSVCCPLEHALDLLYTADMLFLDSLKTKAAVAISTLGSSGGGGSGLVHRAHHHH
QQQEEEEEEEPINIYDVIHAAWTLRVQRLEEFAARYLANRLEHYIDDDDFHQLIRESASRIRRREETDSIELLDD
IRYYLSERFRLRFEDAGINGIMTSSADKNPSDDATVVPSPDDDDDDDDGGDGVEDEFTSDAIQYQALLNKIDDVL
VSLDLDA
Coding >Ophio5|6902
ATGGTGCTGCCAAAGCACGAGCTCGAGGGCAAGCTGGGCGAGGAAAGGCTCATGATCAAGAGCGGCTTGCTGCGC
GACGAGAATCCGCTGGACCAGACCCTCGAATTCAACGACTTTCTACTCGCCTGTCGCCGTGGGGACCTTCGTCGC
TGTCAGGAGCTCATCAATCAGGGCGTCAACATCAATGGCAAGGACAAGTTCGACTACACGCCACTCATCATCGCC
AGTCTGTGCGGCCACTACGAGCTCGTGCAGTTACTCCTCGACAGCGGCGCGTTGGCGGAGAGAAACACGTTCCAG
GGCGAACGATGCATCTACAACGCTCTCAACGATCGAATCCGCAACCTCCTGCTGCGCTATGACTTTTCTAAATCC
GCCGACCCTTACGTCTACTGGTCCACGCACCTTACCACTCTCCTGAGTCGGGATAAGCCTGCCACGTCGGACTTG
CGCCTCGTCTCCGGGCCGCGCTCTTTTCGTCTGCATAGGTTTCTACTCGTCGCTCGCACGCCATACTTCCGCTCC
AGACTCGAGGCTCAGCCTGAGACGACGTCGTGGAATCTGAATCCTGCTGTACCGTCAGAGGCTGTGCACATTGCC
TTGCGTTATCTGTATCTCGATCAGCTTCCGGCTGACCTCGTTCCGCCGGATAGAAGCAATTCTGTTTCCGAGGAT
GACGTCGCGAAGGGCCTCATCAAGATTAGCAAGCAGCTTGGTGTCGAGAGGTTATGGGACGCTGTCGTGGCGTGC
TCTGATCGGAGGCTCGTCCGACAGCGGTATCGAGACGAGGAGGAGCGGGCCGTTGAGGAGATTGGCGACTTTTTT
CGCCTTCGCGTTCTCGGTGGCAAGATGGTCGTCGATACGGATCGCGTGTCTGACGTGCGGCTCCGGCTCGATAAC
GCTGCTTTCGCCGACGTCTTGCTCCGGGCCGACGAGCCGTCCGTAAACAGCGACGAAGACGCAGCCTCGTCGCCT
CCCCTTCTCAACAGCCAAGGCATCCCTCTGGGTCCCCGGCCTAGCAAGTCGGTGCTGTTTCCATGCCACAAGGCG
ATGCTCATCCGCAGCGAATACTTCGCCATCATGTTCTCCGGAGACTTCATCGAGGCTCAGGAGTCTCCTCACCTG
CGCGTCATCACCGTCGACTGCACGCCCGCCGTGCTCGAGCTCGTCCTCACCTATCTCTACACAGACAGCGTCTGC
TGCCCGCTCGAACACGCCCTCGACCTGCTCTACACGGCCGACATGCTCTTCCTCGATAGTCTCAAGACCAAAGCC
GCCGTGGCCATCAGCACGCTCGGAAGCAGCGGCGGCGGCGGAAGCGGCCTCGTCCATCGGGCTCATCATCATCAT
CAGCAGCAGGAGGAGGAAGAGGAGGAGGAGCCGATCAACATCTACGACGTCATTCATGCTGCTTGGACCCTGCGC
GTGCAGCGGCTGGAAGAGTTCGCCGCCCGTTATCTCGCAAACAGGCTGGAGCATTACATCGACGACGACGACTTT
CACCAACTCATCCGCGAAAGCGCCTCGCGCATTCGTCGTCGAGAGGAGACGGATTCGATTGAGCTGTTGGATGAT
ATCCGCTACTACCTCTCGGAACGCTTCCGTCTACGGTTCGAGGACGCCGGCATCAACGGCATCATGACCTCGTCG
GCTGATAAGAATCCGTCCGACGATGCTACTGTCGTGCCCTCGCCCGACGACGACGACGACGACGACGACGGCGGC
GATGGTGTCGAGGATGAGTTTACGTCGGACGCCATCCAGTACCAGGCGCTGCTGAACAAGATTGATGATGTGCTT
GTGAGCCTCGATCTGGATGCT
Transcript >Ophio5|6902
ATGGTGCTGCCAAAGCACGAGCTCGAGGGCAAGCTGGGCGAGGAAAGGCTCATGATCAAGAGCGGCTTGCTGCGC
GACGAGAATCCGCTGGACCAGACCCTCGAATTCAACGACTTTCTACTCGCCTGTCGCCGTGGGGACCTTCGTCGC
TGTCAGGAGCTCATCAATCAGGGCGTCAACATCAATGGCAAGGACAAGTTCGACTACACGCCACTCATCATCGCC
AGTCTGTGCGGCCACTACGAGCTCGTGCAGTTACTCCTCGACAGCGGCGCGTTGGCGGAGAGAAACACGTTCCAG
GGCGAACGATGCATCTACAACGCTCTCAACGATCGAATCCGCAACCTCCTGCTGCGCTATGACTTTTCTAAATCC
GCCGACCCTTACGTCTACTGGTCCACGCACCTTACCACTCTCCTGAGTCGGGATAAGCCTGCCACGTCGGACTTG
CGCCTCGTCTCCGGGCCGCGCTCTTTTCGTCTGCATAGGTTTCTACTCGTCGCTCGCACGCCATACTTCCGCTCC
AGACTCGAGGCTCAGCCTGAGACGACGTCGTGGAATCTGAATCCTGCTGTACCGTCAGAGGCTGTGCACATTGCC
TTGCGTTATCTGTATCTCGATCAGCTTCCGGCTGACCTCGTTCCGCCGGATAGAAGCAATTCTGTTTCCGAGGAT
GACGTCGCGAAGGGCCTCATCAAGATTAGCAAGCAGCTTGGTGTCGAGAGGTTATGGGACGCTGTCGTGGCGTGC
TCTGATCGGAGGCTCGTCCGACAGCGGTATCGAGACGAGGAGGAGCGGGCCGTTGAGGAGATTGGCGACTTTTTT
CGCCTTCGCGTTCTCGGTGGCAAGATGGTCGTCGATACGGATCGCGTGTCTGACGTGCGGCTCCGGCTCGATAAC
GCTGCTTTCGCCGACGTCTTGCTCCGGGCCGACGAGCCGTCCGTAAACAGCGACGAAGACGCAGCCTCGTCGCCT
CCCCTTCTCAACAGCCAAGGCATCCCTCTGGGTCCCCGGCCTAGCAAGTCGGTGCTGTTTCCATGCCACAAGGCG
ATGCTCATCCGCAGCGAATACTTCGCCATCATGTTCTCCGGAGACTTCATCGAGGCTCAGGAGTCTCCTCACCTG
CGCGTCATCACCGTCGACTGCACGCCCGCCGTGCTCGAGCTCGTCCTCACCTATCTCTACACAGACAGCGTCTGC
TGCCCGCTCGAACACGCCCTCGACCTGCTCTACACGGCCGACATGCTCTTCCTCGATAGTCTCAAGACCAAAGCC
GCCGTGGCCATCAGCACGCTCGGAAGCAGCGGCGGCGGCGGAAGCGGCCTCGTCCATCGGGCTCATCATCATCAT
CAGCAGCAGGAGGAGGAAGAGGAGGAGGAGCCGATCAACATCTACGACGTCATTCATGCTGCTTGGACCCTGCGC
GTGCAGCGGCTGGAAGAGTTCGCCGCCCGTTATCTCGCAAACAGGCTGGAGCATTACATCGACGACGACGACTTT
CACCAACTCATCCGCGAAAGCGCCTCGCGCATTCGTCGTCGAGAGGAGACGGATTCGATTGAGCTGTTGGATGAT
ATCCGCTACTACCTCTCGGAACGCTTCCGTCTACGGTTCGAGGACGCCGGCATCAACGGCATCATGACCTCGTCG
GCTGATAAGAATCCGTCCGACGATGCTACTGTCGTGCCCTCGCCCGACGACGACGACGACGACGACGACGGCGGC
GATGGTGTCGAGGATGAGTTTACGTCGGACGCCATCCAGTACCAGGCGCTGCTGAACAAGATTGATGATGTGCTT
GTGAGCCTCGATCTGGATGCTTGA
Gene >Ophio5|6902
ATGGTGCTGCCAAAGCACGAGCTCGAGGGCAAGCTGGGCGAGGAAAGGCTCATGATCAAGAGCGGCTTGCTGCGC
GACGAGAATCCGCTGGACCAGACCCTCGAATTCAACGACTTTCTACTCGCCTGTCGCCGTGGGGACCTTCGTCGC
TGTCAGGAGCTCATCAATCAGGGCGTCAACATCAATGGCAAGGACAAGTTCGACTACACGCCACTCATCATCGTG
AGCCCTCGCATTCCGCTGTAACCCTCTTTTTCCCTCGGCTGACCGGTCCGCTCCGCGCAGGCCAGTCTGTGCGGC
CACTACGAGCTCGTGCAGTTACTCCTCGACAGCGGTACGCCTCAGACGCACACGCCCCCCCCTCCCCCCTTTTTT
CCCTAGCCCCCCGAGTGTCACAACCATCGGCCCGCCGCACAGACGAGAGAGACAACAAGGAAAACATAGGGGATC
TCGCTGACGGGAAAGCCGGTCTCGCAGGCGCGTTGGCGGAGAGAAACACGTTCCAGGGCGAACGATGCATCTACA
ACGCTCTCAACGATCGAATCCGCAACCTCCTGCTGCGCTATGACTTTTCTAAATCCGCCGACCCTTACGTCTACT
GGTCCACGCACCTTACCACTCTCCTGAGTCGGGATAAGCCTGCCACGTCGGACTTGCGCCTCGTCTCCGGGCCGC
GCTCTTTTCGTCTGCATAGGTTTCTACTCGTCGCTCGCACGCCATACTTCCGCTCCAGACTCGAGGCTCAGCCTG
AGACGACGTCGTGGAATCTGAATCCTGCTGTACCGTCAGAGGCTGTGCACATTGCCTTGCGTTATCTGTATCTCG
ATCAGCTTCCGGCTGACCTCGTTCCGCCGGATAGAAGCAATTCTGTTTCCGAGGATGACGTCGCGAAGGGCCTCA
TCAAGATTAGCAAGCAGCTTGGTGTCGAGAGGTTATGGGACGCTGTCGTGGCGTGCTCTGATCGGAGGCTCGTCC
GACAGCGGTATCGAGACGAGGAGGAGCGGGCCGTTGAGGAGATTGGCGACTTTTTTCGCCTTCGCGTTCTCGGTG
GCAAGATGGTCGTCGATACGGATCGCGTGTCTGACGTGCGGCTCCGGCTCGATAACGCTGCTTTCGCCGACGTCT
TGCTCCGGGCCGACGAGCCGTCCGTAAACAGCGACGAAGACGCAGCCTCGTCGCCTCCCCTTCTCAACAGCCAAG
GCATCCCTCTGGGTCCCCGGCCTAGCAAGTCGGTGCTGTTTCCATGCCACAAGGCGATGCTCATCCGCAGCGAAT
ACTTCGCCATCATGTTCTCCGGAGACTTCATCGAGGCTCAGGAGTCTCCTCACCTGCGCGTCATCACCGTCGACT
GCACGCCCGCCGTGCTCGAGCTCGTCCTCACCTATCTCTACACAGACAGCGTCTGCTGCCCGCTCGAACACGCCC
TCGACCTGCTCTACACGGCCGACATGCTCTTCCTCGATAGTCTCAAGACCAAAGCCGCCGTGGCCATCAGCACGC
TCGGAAGCAGCGGCGGCGGCGGAAGCGGCCTCGTCCATCGGGCTCATCATCATCATCAGCAGCAGGAGGAGGAAG
AGGAGGAGGAGCCGATCAACATCTACGACGTCATTCATGCTGCTTGGACCCTGCGCGTGCAGCGGCTGGAAGAGT
TCGCCGCCCGTTATCTCGCAAACAGGCTGGAGCATTACATCGACGACGACGACTTTCACCAACTCATCCGCGAAA
GCGCCTCGCGCATTCGTCGTCGAGAGGAGACGGATTCGATTGAGCTGTTGGATGATATCCGCTACTACCTCTCGG
AACGCTTCCGTCTACGGTTCGAGGACGCCGGCATCAACGGCATCATGACCTCGTCGGCTGATAAGAATCCGTCCG
ACGATGCTACTGTCGTGCCCTCGCCCGACGACGACGACGACGACGACGACGGCGGCGATGGTGTCGAGGATGAGT
TTACGTCGGACGCCATCCAGTACCAGGCGCTGCTGAACAAGATTGATGATGTGCTTGTGAGCCTCGATCTGGATG
CTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail