Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6896
Gene name
Locationscaffold_627:8851..10708
Strand-
Gene length (bp)1857
Transcript length (bp)1743
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-10 28 148
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-10 203 471

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 58 80 22
3 85 107 22
4 117 139 22
5 204 226 22
6 241 263 22
7 332 354 22
8 380 402 22
9 409 431 22
10 446 468 22
11 522 544 22
12 554 571 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6896
MPSVSRFLPFSASTTTAQAVTYLLGVSLFSISFLVFLNSSVSFVITDLIGQKDNVGDVVGTLGFADELVALVACP
AWGLVSDRLGVRWVATIGYAVIGVALAVFVQARNVYPQLLLARLFFAIGASASATMVTAILPSLTDEADTMTAAS
GPSRVKHNSRLSAAFSVESEATITPERYTRTLSQERARSPTWDAAAKPGKPSALAGFVGSFTGCGALVSLALFLP
LPARFGRLDNVTPGQAVEYSFYVVGAVSLAVALFVSVGLRNLRGEEGKGWRALFGIRSRYDALDQLEPDDAHRRP
KRDVLPYLRLMKDSVWLGLTDSRIAIGYIGGFVARASTVAISLFIPLLVNTYFIDNGFCRGSPSDPSPELKKECR
AAYVLSSILTGVAQLMGLVCAPVFGYLSGRTGRVNYPVVAASSFGIIGYMILPHLSSPEVTNVDGRGGSPVILLI
VALVGVSQIGAIVCSLGSLGQGVLEAELPRSAIGDEPSMAPDDEDEAAESDPLVSAPAESEPLSRVRLKGSIAGV
YSLCGGAAILILTKMGGVLFDRLSHGAPFYMMAAFNGIWLVTSLLLDASQAYAAS
Coding >Ophio5|6896
ATGCCGTCGGTCTCGCGATTCCTGCCCTTCTCGGCGTCGACGACGACGGCCCAGGCGGTGACGTATCTGCTGGGC
GTCTCCCTCTTCTCCATCTCCTTTCTCGTCTTCCTCAATAGTTCCGTGTCATTTGTCATAACCGACTTGATTGGC
CAAAAGGACAATGTCGGCGACGTCGTCGGCACCCTAGGCTTCGCCGACGAGTTAGTCGCCCTGGTCGCCTGTCCG
GCCTGGGGCCTCGTCTCGGACCGGCTCGGCGTTCGCTGGGTGGCCACCATCGGCTATGCTGTCATCGGCGTTGCG
CTGGCCGTCTTCGTCCAGGCCCGAAATGTATATCCGCAGCTGCTTCTCGCGCGTCTGTTCTTCGCCATTGGCGCG
TCGGCATCGGCTACCATGGTTACTGCCATACTTCCTTCGCTGACGGACGAGGCCGACACCATGACGGCCGCCTCG
GGCCCCTCACGTGTCAAGCACAATTCCCGCCTCAGCGCCGCCTTTTCCGTCGAGTCCGAAGCTACCATCACGCCG
GAGAGGTACACGAGAACCTTGTCCCAGGAGCGGGCGCGGAGCCCGACGTGGGACGCCGCGGCCAAACCCGGAAAG
CCGTCGGCGCTGGCCGGCTTTGTGGGCTCCTTTACGGGCTGCGGTGCTCTCGTGTCATTGGCTCTGTTCCTGCCG
CTGCCGGCGAGGTTCGGCAGACTTGACAACGTCACGCCCGGGCAGGCTGTCGAGTACAGCTTCTACGTGGTCGGG
GCCGTGTCCTTGGCTGTCGCGCTCTTCGTCTCGGTCGGATTGCGAAACTTGAGGGGCGAAGAGGGAAAAGGCTGG
AGAGCGCTCTTTGGCATCCGGAGCCGATACGATGCCCTCGACCAGCTCGAGCCTGACGACGCGCACAGGCGGCCG
AAAAGGGACGTGCTTCCCTACCTCCGCCTGATGAAGGACTCGGTATGGCTGGGCTTGACGGACTCGAGGATCGCC
ATTGGCTATATCGGCGGCTTCGTCGCGAGGGCGTCTACGGTGGCCATCTCCCTCTTCATTCCGCTGCTCGTCAAC
ACGTACTTCATCGACAACGGCTTCTGTCGTGGCTCGCCCAGCGATCCGTCGCCCGAGCTGAAGAAGGAATGTCGG
GCAGCCTATGTGCTGTCGTCGATCCTGACGGGAGTCGCGCAGCTGATGGGCCTGGTGTGCGCGCCTGTCTTTGGC
TATCTCTCCGGGCGGACCGGACGGGTCAACTACCCCGTCGTGGCTGCCAGCTCGTTTGGAATTATCGGCTACATG
ATCCTGCCGCACCTGTCGAGCCCTGAAGTGACAAACGTGGACGGGCGGGGCGGCAGCCCGGTGATTCTGCTCATC
GTTGCCCTTGTCGGCGTCAGCCAGATCGGGGCTATTGTCTGTAGCCTGGGCTCGCTGGGCCAGGGCGTGCTCGAG
GCGGAACTGCCGCGGTCCGCAATCGGCGACGAGCCGTCCATGGCGCCCGACGACGAGGACGAGGCGGCCGAGTCG
GACCCGCTCGTATCCGCGCCGGCCGAAAGCGAGCCGTTGTCTAGGGTGCGGCTCAAGGGTTCAATTGCCGGCGTC
TATTCATTGTGCGGGGGCGCGGCCATCCTGATCCTCACTAAGATGGGAGGCGTACTGTTTGACAGGCTGTCACAC
GGGGCGCCGTTTTACATGATGGCCGCTTTCAACGGCATCTGGCTGGTGACCAGCTTGCTGTTGGACGCTTCGCAG
GCTTACGCGGCAAGC
Transcript >Ophio5|6896
ATGCCGTCGGTCTCGCGATTCCTGCCCTTCTCGGCGTCGACGACGACGGCCCAGGCGGTGACGTATCTGCTGGGC
GTCTCCCTCTTCTCCATCTCCTTTCTCGTCTTCCTCAATAGTTCCGTGTCATTTGTCATAACCGACTTGATTGGC
CAAAAGGACAATGTCGGCGACGTCGTCGGCACCCTAGGCTTCGCCGACGAGTTAGTCGCCCTGGTCGCCTGTCCG
GCCTGGGGCCTCGTCTCGGACCGGCTCGGCGTTCGCTGGGTGGCCACCATCGGCTATGCTGTCATCGGCGTTGCG
CTGGCCGTCTTCGTCCAGGCCCGAAATGTATATCCGCAGCTGCTTCTCGCGCGTCTGTTCTTCGCCATTGGCGCG
TCGGCATCGGCTACCATGGTTACTGCCATACTTCCTTCGCTGACGGACGAGGCCGACACCATGACGGCCGCCTCG
GGCCCCTCACGTGTCAAGCACAATTCCCGCCTCAGCGCCGCCTTTTCCGTCGAGTCCGAAGCTACCATCACGCCG
GAGAGGTACACGAGAACCTTGTCCCAGGAGCGGGCGCGGAGCCCGACGTGGGACGCCGCGGCCAAACCCGGAAAG
CCGTCGGCGCTGGCCGGCTTTGTGGGCTCCTTTACGGGCTGCGGTGCTCTCGTGTCATTGGCTCTGTTCCTGCCG
CTGCCGGCGAGGTTCGGCAGACTTGACAACGTCACGCCCGGGCAGGCTGTCGAGTACAGCTTCTACGTGGTCGGG
GCCGTGTCCTTGGCTGTCGCGCTCTTCGTCTCGGTCGGATTGCGAAACTTGAGGGGCGAAGAGGGAAAAGGCTGG
AGAGCGCTCTTTGGCATCCGGAGCCGATACGATGCCCTCGACCAGCTCGAGCCTGACGACGCGCACAGGCGGCCG
AAAAGGGACGTGCTTCCCTACCTCCGCCTGATGAAGGACTCGGTATGGCTGGGCTTGACGGACTCGAGGATCGCC
ATTGGCTATATCGGCGGCTTCGTCGCGAGGGCGTCTACGGTGGCCATCTCCCTCTTCATTCCGCTGCTCGTCAAC
ACGTACTTCATCGACAACGGCTTCTGTCGTGGCTCGCCCAGCGATCCGTCGCCCGAGCTGAAGAAGGAATGTCGG
GCAGCCTATGTGCTGTCGTCGATCCTGACGGGAGTCGCGCAGCTGATGGGCCTGGTGTGCGCGCCTGTCTTTGGC
TATCTCTCCGGGCGGACCGGACGGGTCAACTACCCCGTCGTGGCTGCCAGCTCGTTTGGAATTATCGGCTACATG
ATCCTGCCGCACCTGTCGAGCCCTGAAGTGACAAACGTGGACGGGCGGGGCGGCAGCCCGGTGATTCTGCTCATC
GTTGCCCTTGTCGGCGTCAGCCAGATCGGGGCTATTGTCTGTAGCCTGGGCTCGCTGGGCCAGGGCGTGCTCGAG
GCGGAACTGCCGCGGTCCGCAATCGGCGACGAGCCGTCCATGGCGCCCGACGACGAGGACGAGGCGGCCGAGTCG
GACCCGCTCGTATCCGCGCCGGCCGAAAGCGAGCCGTTGTCTAGGGTGCGGCTCAAGGGTTCAATTGCCGGCGTC
TATTCATTGTGCGGGGGCGCGGCCATCCTGATCCTCACTAAGATGGGAGGCGTACTGTTTGACAGGCTGTCACAC
GGGGCGCCGTTTTACATGATGGCCGCTTTCAACGGCATCTGGCTGGTGACCAGCTTGCTGTTGGACGCTTCGCAG
GCTTACGCGGCAAGCTGA
Gene >Ophio5|6896
ATGCCGTCGGTCTCGCGATTCCTGCCCTTCTCGGCGTCGACGACGACGGCCCAGGCGGTGACGTATCTGCTGGGC
GTCTCCCTCTTCTCCATCTCCTTTCTCGTCTTCCTCAATAGTTCCGTGTCATTTGTCATAACCGACTTGATTGGC
CAAAAGGACAATGTCGGCGACGTCGTCGGCACCCTAGGCTTCGCCGACGAGTTAGTCGCCCTGGTCGCCTGTCCG
GCCTGGGGCCTCGTCTCGGACCGGCTCGGCGTTCGCTGGGTGGCCACCATCGGCTATGCTGTCATCGGCGTTGCG
CTGGCCGTCTTCGTCCAGGCCCGAAATGTATATCCGCAGCTGCTTCTCGCGCGTCTGTTCTTCGCCATTGGCGCG
TCGGCATCGTGAGTCCTGCCGAGATGTGCGGTGGCGAGGGAGTGGCTAACGGCTCGGTCCTTTCGTAGGGCTACC
ATGGTTACTGCCATACTTCCTTCGCTGACGGACGAGGCCGACACCATGACGGCCGCCTCGGGCCCCTCACGTGTC
AAGCACAATTCCCGCCTCAGCGCCGCCTTTTCCGTCGAGTCCGAAGCTACCATCACGCCGGAGAGGTACACGAGA
ACCTTGTCCCAGGAGCGGGCGCGGAGCCCGACGTGGGACGCCGCGGCCAAACCCGGAAAGCCGTCGGCGCTGGCC
GGCTTTGTGGGCTCCTTTACGGGCTGCGGTGCTCTCGTGTCATTGGCTCTGTTCCTGCCGCTGCCGGCGAGGTTC
GGCAGACTTGACAACGTCACGCCCGGGCAGGCTGTCGAGTACAGCTTCTACGTGGTCGGGGCCGTGTCCTTGGCT
GTCGCGCTCTTCGTCTCGGTCGGATTGCGAAACTTGAGGGGCGAAGAGGGAAAAGGCTGGAGAGCGCTCTTTGGC
ATCCGGAGCCGATACGATGCCCTCGACCAGCTCGAGCCTGACGACGCGCACAGGCGGCCGAAAAGGGTAGGTTTC
TGCGAGGCGTCGTTTTCAACACTAGCGGGCTGACCACGGCTGCAGGACGTGCTTCCCTACCTCCGCCTGATGAAG
GACTCGGTATGGCTGGGCTTGACGGACTCGAGGATCGCCATTGGCTATATCGGCGGCTTCGTCGCGAGGGCGTCT
ACGGTGGCCATCTCCCTCTTCATTCCGCTGCTCGTCAACACGTACTTCATCGACAACGGCTTCTGTCGTGGCTCG
CCCAGCGATCCGTCGCCCGAGCTGAAGAAGGAATGTCGGGCAGCCTATGTGCTGTCGTCGATCCTGACGGGAGTC
GCGCAGCTGATGGGCCTGGTGTGCGCGCCTGTCTTTGGCTATCTCTCCGGGCGGACCGGACGGGTCAACTACCCC
GTCGTGGCTGCCAGCTCGTTTGGAATTATCGGCTACATGATCCTGCCGCACCTGTCGAGCCCTGAAGTGACAAAC
GTGGACGGGCGGGGCGGCAGCCCGGTGATTCTGCTCATCGTTGCCCTTGTCGGCGTCAGCCAGATCGGGGCTATT
GTCTGTAGCCTGGGCTCGCTGGGCCAGGGCGTGCTCGAGGCGGAACTGCCGCGGTCCGCAATCGGCGACGAGCCG
TCCATGGCGCCCGACGACGAGGACGAGGCGGCCGAGTCGGACCCGCTCGTATCCGCGCCGGCCGAAAGCGAGCCG
TTGTCTAGGGTGCGGCTCAAGGGTTCAATTGCCGGCGTCTATTCATTGTGCGGGGGCGCGGCCATCCTGATCCTC
ACTAAGATGGGAGGCGTACTGTTTGACAGGCTGTCACACGGGGCGCCGTTTTACATGATGGCCGCTTTCAACGGC
ATCTGGCTGGTGACCAGCTTGCTGTTGGACGCTTCGCAGGCTTACGCGGCAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail