Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6891
Gene name
Locationscaffold_626:2378..6372
Strand+
Gene length (bp)3994
Transcript length (bp)3750
Coding sequence length (bp)3747
Protein length (aa) 1249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 8.2E-60 52 1227
PF06470 SMC_hinge SMC proteins Flexible Hinge Domain 1.6E-25 572 684
PF13476 AAA_23 AAA domain 5.0E-19 55 258
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 2.0E-08 991 1206
PF13175 AAA_15 AAA ATPase domain 6.1E-09 51 403

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42649|SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm3 PE=1 SV=1 51 1244 0.0E+00
sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 51 1245 0.0E+00
sp|B2FDA8|SMC3_CAEEL Structural maintenance of chromosomes protein 3 OS=Caenorhabditis elegans GN=smc-3 PE=1 SV=1 51 1243 0.0E+00
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 51 1249 0.0E+00
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 51 1220 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42649|SMC3_SCHPO Structural maintenance of chromosomes protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm3 PE=1 SV=1 51 1244 0.0E+00
sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 51 1245 0.0E+00
sp|B2FDA8|SMC3_CAEEL Structural maintenance of chromosomes protein 3 OS=Caenorhabditis elegans GN=smc-3 PE=1 SV=1 51 1243 0.0E+00
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 51 1249 0.0E+00
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 51 1220 0.0E+00
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 51 1243 0.0E+00
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protein 3 OS=Pongo abelii GN=SMC3 PE=2 SV=1 51 1243 0.0E+00
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus GN=Smc3 PE=1 SV=2 51 1243 0.0E+00
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 51 1243 0.0E+00
sp|O93309|SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis GN=smc3 PE=1 SV=2 51 1243 0.0E+00
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 51 1243 0.0E+00
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 51 1242 6.0E-176
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 51 1233 4.0E-62
sp|Q54PK4|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1 51 1233 2.0E-60
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2 51 1233 5.0E-58
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2 51 1234 2.0E-55
sp|Q8I1U7|SMC3_PLAF7 Structural maintenance of chromosomes protein 3 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFD0685c PE=3 SV=1 51 709 2.0E-54
sp|B8CW13|SMC_HALOH Chromosome partition protein Smc OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=smc PE=3 SV=1 51 1231 4.0E-52
sp|Q69GZ5|SMC_METVO Chromosome partition protein Smc OS=Methanococcus voltae GN=smc PE=3 SV=1 53 1233 8.0E-49
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protein 2 OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.96 PE=3 SV=1 51 1234 8.0E-49
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=smc PE=3 SV=2 53 1233 3.0E-48
sp|B9E1H0|SMC_CLOK1 Chromosome partition protein Smc OS=Clostridium kluyveri (strain NBRC 12016) GN=smc PE=3 SV=1 50 1233 9.0E-46
sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 46 1221 4.0E-45
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 51 1223 4.0E-41
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1 51 855 7.0E-41
sp|P32908|SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC1 PE=1 SV=1 58 1243 6.0E-40
sp|Q8KBS6|SMC_CHLTE Chromosome partition protein Smc OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=smc PE=3 SV=1 51 1238 3.0E-39
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 51 852 2.0E-38
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 51 733 2.0E-37
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 51 1239 2.0E-37
sp|Q7ZAK1|SMC_THEEB Chromosome partition protein Smc OS=Thermosynechococcus elongatus (strain BP-1) GN=smc PE=3 SV=1 51 1222 2.0E-36
sp|Q54LV0|SMC4_DICDI Structural maintenance of chromosomes protein 4 OS=Dictyostelium discoideum GN=smc4 PE=3 SV=1 51 1221 2.0E-36
sp|P50532|SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis GN=smc4 PE=1 SV=1 44 1228 2.0E-34
sp|Q9FJL0|SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana GN=SMC4 PE=1 SV=1 41 1249 3.0E-33
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=smc PE=3 SV=1 52 1230 2.0E-32
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=smc PE=3 SV=2 51 1237 9.0E-31
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2 51 397 4.0E-30
sp|P73340|SMC_SYNY3 Chromosome partition protein Smc OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=smc PE=3 SV=1 51 751 8.0E-29
sp|Q7NG51|SMC_GLOVI Chromosome partition protein Smc OS=Gloeobacter violaceus (strain PCC 7421) GN=smc PE=3 SV=1 468 1223 1.0E-28
sp|Q90988|SMC2_CHICK Structural maintenance of chromosomes protein 2 OS=Gallus gallus GN=SMC2 PE=2 SV=1 51 277 1.0E-28
sp|Q8TZY2|SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=smc PE=1 SV=2 1017 1243 2.0E-27
sp|Q88WJ9|SMC_LACPL Chromosome partition protein Smc OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=smc PE=3 SV=1 539 1231 3.0E-26
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 51 708 3.0E-26
sp|Q24U48|SMC_DESHY Chromosome partition protein Smc OS=Desulfitobacterium hafniense (strain Y51) GN=smc PE=3 SV=1 44 274 3.0E-23
sp|O66878|SMC_AQUAE Chromosome partition protein Smc OS=Aquifex aeolicus (strain VF5) GN=smc PE=3 SV=1 826 1236 1.0E-21
sp|Q1INB1|SMC_KORVE Chromosome partition protein Smc OS=Koribacter versatilis (strain Ellin345) GN=smc PE=3 SV=1 143 1233 2.0E-21
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 51 492 2.0E-19
sp|Q8NDV3|SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens GN=SMC1B PE=2 SV=2 52 1245 9.0E-19
sp|Q81ZL2|SMC_COXBU Chromosome partition protein Smc OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=smc PE=3 SV=1 917 1244 2.0E-18
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 44 708 1.0E-17
sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 524 1221 8.0E-17
sp|Q9CBT5|SMC_MYCLE Chromosome partition protein Smc OS=Mycobacterium leprae (strain TN) GN=smc PE=3 SV=1 51 261 8.0E-17
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 51 425 2.0E-16
sp|Q7UQV4|SMC_RHOBA Chromosome partition protein Smc OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=smc PE=3 SV=2 53 289 3.0E-16
sp|Q604U6|SMC_METCA Chromosome partition protein Smc OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=smc PE=3 SV=2 51 271 4.0E-16
sp|P9WGF3|SMC_MYCTU Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=smc PE=1 SV=1 1009 1236 4.0E-16
sp|P9WGF2|SMC_MYCTO Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=smc PE=3 SV=1 1009 1236 4.0E-16
sp|Q73VM3|SMC_MYCPA Chromosome partition protein Smc OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=smc PE=3 SV=2 1011 1233 8.0E-16
sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 522 1221 1.0E-15
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 993 1237 3.0E-15
sp|Q3JR19|SMC_BURP1 Chromosome partition protein Smc OS=Burkholderia pseudomallei (strain 1710b) GN=smc PE=3 SV=2 739 1243 4.0E-15
sp|P51834|SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) GN=smc PE=1 SV=3 51 276 6.0E-15
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 51 277 7.0E-15
sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 42 708 8.0E-15
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 871 1249 9.0E-15
sp|Q604U6|SMC_METCA Chromosome partition protein Smc OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=smc PE=3 SV=2 999 1237 2.0E-14
sp|Q3JR19|SMC_BURP1 Chromosome partition protein Smc OS=Burkholderia pseudomallei (strain 1710b) GN=smc PE=3 SV=2 51 324 4.0E-14
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 51 324 5.0E-14
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 1000 1243 6.0E-13
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 1009 1246 1.0E-12
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 51 271 6.0E-12
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 1009 1243 7.0E-12
sp|O01789|SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans GN=him-1 PE=1 SV=4 45 963 1.0E-11
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 51 218 1.0E-11
sp|P15016|YAT3_RHORU Uncharacterized protein in ATPase CF(0) subunits 3'region (Fragment) OS=Rhodospirillum rubrum PE=4 SV=1 1062 1249 3.0E-10
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 51 250 3.0E-10
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 51 232 4.0E-10
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 51 253 6.0E-10
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 978 1237 7.0E-10
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 55 346 1.0E-09
sp|Q5N0D2|SMC_SYNP6 Chromosome partition protein Smc OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=smc PE=3 SV=2 990 1222 2.0E-09
sp|Q5N0D2|SMC_SYNP6 Chromosome partition protein Smc OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=smc PE=3 SV=2 51 287 5.0E-09
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 1142 1240 1.0E-08
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 573 717 1.0E-08
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 1142 1221 1.0E-08
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 51 279 2.0E-08
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 1017 1233 2.0E-07
sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 1140 1221 6.0E-07
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 1145 1248 6.0E-07
sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 1142 1221 6.0E-07
sp|Q920F6|SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus GN=Smc1b PE=1 SV=1 1060 1237 2.0E-06
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 1145 1248 3.0E-06
sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes protein 1A OS=Bos taurus GN=SMC1A PE=1 SV=1 1145 1248 3.0E-06
sp|Q6Q1P4|SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana GN=SMC1 PE=2 SV=2 1142 1244 3.0E-06
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 1145 1248 3.0E-06
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 1145 1248 3.0E-06
sp|O01789|SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans GN=him-1 PE=1 SV=4 1142 1241 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140664 ATP-dependent DNA damage sensor activity Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0051276 chromosome organization Yes
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0005694 chromosome Yes
GO:0043226 organelle No
GO:0030554 adenyl nucleotide binding No
GO:0016787 hydrolase activity No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0140612 DNA damage sensor activity No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043228 non-membrane-bounded organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0140657 ATP-dependent activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0140097 catalytic activity, acting on DNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140299 small molecule sensor activity No
GO:0006996 organelle organization No
GO:1901265 nucleoside phosphate binding No
GO:0071840 cellular component organization or biogenesis No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003824 catalytic activity No
GO:0017111 nucleoside-triphosphatase activity No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0017076 purine nucleotide binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0016043 cellular component organization No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6891
MGGTLLGRNSGASRRDFLSACLIAAAAHASQRIAAHEQEIQRPSDVAPPTMYIKQIIIQGFKSYKDQTVIEPFSP
KTNVIVGRNGSGKSNFFAAMRFVLSDAYTQMNREERQGLLHEGSGSAVLSAYVEIIFDNSDDRFPTGGKEVILRR
TIGLKKDEYSVDRKVVTKNDVMNLLEAAGFSRSNPYYIVPQGRVTALTNMKESDRLNLLKEVAGTHVYETRRAES
LKIMNETNNKREKIDELLEYIKERLTELEEEKEELRGFQEKDRERRCLEYAYHHNEQMTIQSTLEDIDNARQDGL
DTTDSSRSELVEGEKALAKLDAEMHQLQRDLEMLQIDHRQHDEDRRDYAKALAKAELKVKNLEEGQSAQEQAQAK
HAAELESVKADIAAKEKELAKILPQFAKTKRDEDEIRRQLDAAEASRARLFAKQTRGSRFKNKAERDAWLRQEIN
ELDQTISAQKANKLEAEEEVARVQAAISESEQELADLRSRLANWSGERNQLAEQVSQARLTLDKLNDERKLIRRE
DDKLGSVIANARQEKEKAERELAQSVDGATARGLATLRRLRQEQDIPGAYGTLADLLTVSDAYRLPAEQTAGASL
FHYVVDNADTATYLADILHRQRGGRITFMPLAQLRPRHVNLPRTNDAVPLISKITYDAKFDKAFRQVFGKTVVCP
NLTVAGQYARSHGINGITAEGDTTNKRGAMTGGWIDPRKSRLEAVQAANRWRQEYDKLLSRSREIRSQIEGKDQE
ITAAMSEVQKLEQRLRQADDGFEPLKHELMSKSAHLENERTHLDAAMKRRDAVEKNMNGFMEEVAAHEAEMGTEF
KKSLTAAQEQQLEELSVTVQQLQKQWNDMSDGRRKLEKSKQLLEVDLRQNLQMKLDQLNSQAFENSASSASIGGL
KEARRELKKAQKAQQAVEASLEEVEGKMEELNNRMEQVSGEKAEREQTLSEISSKIEKQQKRMEKTLQRKALLTA
QAAECAKNIRELGMLPEEAFDKYENMEAKVITSKLKRVNEAVKKYKHVNKKAFEQYNNFTSQQDHLMKRRKELDA
SQESIEELVEHLDRRKDEAIERTFKQVSREFATIFGKLVPAGHGRLVIQRRTDRRQEADESDEEARGSVENYTGV
GISVSFNSKHLDEQQKIQQLSGGQKSLCALCLIFALQATESSPMVIFDEVDANLDAQYRTAVASLLESISNEIGT
QFICTTFRPEIVHVADKCYGVTFRNKTSGISCVSTEDALNFVEGQAKPA
Coding >Ophio5|6891
ATGGGAGGCACTCTTCTAGGCAGAAATAGTGGGGCATCCAGACGCGACTTTCTAAGCGCCTGCTTAATCGCCGCG
GCGGCGCACGCGTCGCAGCGCATCGCCGCCCACGAGCAAGAAATTCAACGCCCCTCTGATGTCGCGCCGCCGACG
ATGTATATCAAGCAGATAATCATCCAGGGCTTCAAAAGCTACAAAGACCAGACCGTCATCGAGCCCTTCTCGCCA
AAGACAAACGTCATCGTCGGTCGCAATGGCTCCGGCAAGAGCAACTTCTTCGCCGCCATGCGCTTCGTTCTCAGT
GATGCCTATACCCAGATGAACCGCGAGGAACGACAGGGTCTGCTGCATGAGGGCTCTGGATCAGCCGTCTTGTCG
GCTTACGTCGAGATCATCTTCGACAACAGCGACGATCGCTTCCCCACGGGCGGAAAAGAGGTTATACTACGGCGC
ACGATTGGTCTCAAGAAGGATGAGTACTCGGTCGATCGCAAGGTCGTCACAAAAAACGACGTCATGAACTTGCTC
GAGGCGGCGGGCTTTTCGCGCTCCAACCCCTACTACATCGTGCCCCAGGGACGCGTCACCGCCTTGACCAACATG
AAGGAGTCAGACAGGCTGAACCTGCTCAAGGAGGTGGCCGGCACCCACGTGTACGAGACGCGTCGAGCCGAGTCG
CTCAAGATCATGAACGAGACCAACAACAAGCGGGAAAAGATCGACGAGCTGCTAGAGTACATCAAGGAGAGGCTT
ACCGAGCTGGAGGAGGAGAAGGAAGAGCTCCGCGGATTCCAAGAAAAGGACCGTGAGAGACGGTGTCTCGAATAC
GCCTACCACCACAATGAACAAATGACGATCCAGTCCACCCTCGAGGACATAGACAACGCCAGGCAGGATGGGCTC
GACACCACGGACTCAAGCCGATCCGAGTTGGTCGAGGGTGAAAAGGCTCTCGCCAAATTGGACGCCGAAATGCAC
CAGCTGCAGCGCGACCTCGAGATGCTGCAAATAGATCATCGCCAGCACGACGAGGATCGGCGAGACTACGCAAAG
GCGCTGGCCAAGGCCGAGCTCAAGGTCAAAAATCTCGAGGAAGGGCAGTCGGCGCAGGAGCAGGCTCAGGCAAAG
CACGCGGCCGAGCTGGAATCGGTCAAGGCAGACATTGCGGCCAAGGAAAAGGAGCTGGCCAAGATACTGCCCCAA
TTCGCCAAGACGAAACGGGACGAAGACGAGATCAGACGGCAGCTGGACGCGGCCGAGGCCTCGAGGGCCCGTCTC
TTCGCCAAGCAGACCCGCGGCTCTCGATTTAAGAACAAGGCCGAGAGAGATGCATGGCTGAGGCAGGAGATCAAC
GAGCTCGACCAAACCATCAGCGCCCAAAAAGCAAATAAGCTCGAGGCCGAAGAAGAGGTCGCGAGAGTCCAGGCC
GCCATCAGCGAGAGCGAGCAGGAACTCGCCGACCTCCGGTCGCGCCTCGCCAACTGGAGCGGCGAGAGGAACCAA
CTCGCCGAGCAGGTCTCGCAGGCGAGGCTCACCCTCGACAAGCTCAACGACGAACGGAAGCTCATCCGCCGCGAG
GACGACAAGCTCGGCTCCGTCATCGCGAATGCCAGACAAGAGAAGGAGAAGGCGGAGCGCGAGCTGGCCCAATCC
GTCGACGGCGCGACAGCTCGTGGTCTGGCCACGCTCCGCCGCCTGCGGCAGGAACAGGACATCCCCGGCGCCTAC
GGCACACTGGCCGACCTGCTCACCGTCAGTGACGCCTATCGGCTGCCTGCCGAACAGACGGCGGGCGCGAGCCTG
TTCCACTACGTCGTCGACAACGCCGACACGGCAACATACCTGGCCGACATCCTTCACAGGCAGCGCGGTGGCCGA
ATCACCTTTATGCCGCTCGCACAGCTGCGTCCGCGCCATGTCAACCTGCCGAGAACCAACGACGCGGTGCCGCTG
ATAAGTAAAATCACCTACGACGCCAAGTTCGACAAGGCGTTTCGACAGGTCTTTGGAAAGACGGTCGTGTGTCCA
AATCTGACGGTGGCCGGCCAATACGCCAGGAGCCACGGCATCAATGGCATCACGGCCGAGGGAGACACGACCAAC
AAGAGAGGCGCCATGACAGGCGGATGGATCGATCCTCGCAAGTCGCGGCTGGAGGCCGTACAAGCGGCCAACAGG
TGGCGCCAGGAATACGACAAGCTGCTTTCTCGGTCGCGCGAAATCCGGAGCCAGATCGAGGGCAAAGACCAGGAG
ATTACCGCGGCCATGTCCGAGGTGCAGAAGCTCGAGCAGAGGCTGCGGCAGGCCGACGACGGCTTCGAGCCGCTC
AAGCACGAGCTCATGAGCAAGTCGGCGCACTTGGAAAACGAGCGGACCCATCTCGACGCGGCCATGAAACGACGC
GATGCCGTCGAGAAGAACATGAACGGCTTCATGGAGGAGGTTGCAGCGCACGAAGCCGAGATGGGCACCGAGTTC
AAGAAGAGCCTGACGGCGGCCCAAGAGCAGCAACTGGAAGAGCTGAGCGTGACGGTGCAGCAGCTCCAGAAGCAG
TGGAACGACATGAGCGACGGCCGCAGAAAGCTGGAGAAGTCGAAGCAGCTCCTCGAGGTCGACCTGCGCCAGAAT
CTCCAGATGAAGCTCGACCAACTCAACAGCCAGGCCTTTGAGAACTCGGCATCCTCAGCGTCGATCGGGGGGCTA
AAGGAGGCTCGGAGGGAGCTAAAAAAGGCGCAAAAGGCGCAGCAGGCCGTCGAGGCCAGCCTCGAGGAAGTCGAG
GGTAAGATGGAAGAGCTCAACAACCGGATGGAGCAGGTATCGGGCGAGAAAGCGGAGCGAGAGCAGACGCTGAGC
GAGATCTCGTCCAAGATAGAGAAGCAGCAGAAGAGGATGGAGAAGACGCTGCAGCGCAAAGCGCTTCTGACGGCG
CAGGCGGCAGAGTGTGCCAAGAATATCCGCGAACTCGGGATGCTTCCAGAGGAGGCCTTTGACAAGTACGAGAAC
ATGGAGGCGAAAGTGATCACGTCGAAGCTCAAGCGGGTCAACGAGGCGGTGAAGAAGTACAAGCACGTCAACAAA
AAGGCGTTTGAGCAGTACAACAACTTTACGTCGCAGCAGGACCACCTGATGAAGCGGCGCAAGGAGCTGGACGCG
TCGCAGGAGTCCATCGAGGAGCTTGTCGAGCACCTGGACCGACGAAAGGACGAGGCGATAGAGCGGACCTTCAAA
CAGGTGTCGCGTGAGTTTGCGACGATATTTGGCAAGCTGGTGCCGGCCGGTCATGGCCGGCTCGTCATTCAGCGC
CGGACAGACCGCCGCCAAGAGGCGGACGAGTCGGACGAGGAGGCGAGGGGAAGCGTTGAGAATTATACTGGCGTC
GGCATCAGCGTCTCCTTTAATTCGAAGCATCTGGACGAGCAGCAGAAGATTCAGCAGCTCAGCGGAGGCCAGAAG
AGTCTGTGCGCGCTCTGTCTCATCTTCGCGCTACAGGCGACAGAGAGCAGTCCGATGGTCATCTTCGACGAGGTG
GACGCCAACCTTGACGCCCAATACCGCACCGCCGTCGCGTCCCTGCTCGAGTCCATCTCCAACGAGATCGGGACG
CAATTCATCTGCACCACCTTCCGGCCCGAGATCGTCCACGTGGCCGACAAGTGCTACGGCGTCACGTTCCGCAAC
AAGACGAGTGGCATCAGCTGCGTCAGCACAGAAGACGCCCTCAACTTTGTCGAGGGACAGGCCAAGCCGGCT
Transcript >Ophio5|6891
ATGGGAGGCACTCTTCTAGGCAGAAATAGTGGGGCATCCAGACGCGACTTTCTAAGCGCCTGCTTAATCGCCGCG
GCGGCGCACGCGTCGCAGCGCATCGCCGCCCACGAGCAAGAAATTCAACGCCCCTCTGATGTCGCGCCGCCGACG
ATGTATATCAAGCAGATAATCATCCAGGGCTTCAAAAGCTACAAAGACCAGACCGTCATCGAGCCCTTCTCGCCA
AAGACAAACGTCATCGTCGGTCGCAATGGCTCCGGCAAGAGCAACTTCTTCGCCGCCATGCGCTTCGTTCTCAGT
GATGCCTATACCCAGATGAACCGCGAGGAACGACAGGGTCTGCTGCATGAGGGCTCTGGATCAGCCGTCTTGTCG
GCTTACGTCGAGATCATCTTCGACAACAGCGACGATCGCTTCCCCACGGGCGGAAAAGAGGTTATACTACGGCGC
ACGATTGGTCTCAAGAAGGATGAGTACTCGGTCGATCGCAAGGTCGTCACAAAAAACGACGTCATGAACTTGCTC
GAGGCGGCGGGCTTTTCGCGCTCCAACCCCTACTACATCGTGCCCCAGGGACGCGTCACCGCCTTGACCAACATG
AAGGAGTCAGACAGGCTGAACCTGCTCAAGGAGGTGGCCGGCACCCACGTGTACGAGACGCGTCGAGCCGAGTCG
CTCAAGATCATGAACGAGACCAACAACAAGCGGGAAAAGATCGACGAGCTGCTAGAGTACATCAAGGAGAGGCTT
ACCGAGCTGGAGGAGGAGAAGGAAGAGCTCCGCGGATTCCAAGAAAAGGACCGTGAGAGACGGTGTCTCGAATAC
GCCTACCACCACAATGAACAAATGACGATCCAGTCCACCCTCGAGGACATAGACAACGCCAGGCAGGATGGGCTC
GACACCACGGACTCAAGCCGATCCGAGTTGGTCGAGGGTGAAAAGGCTCTCGCCAAATTGGACGCCGAAATGCAC
CAGCTGCAGCGCGACCTCGAGATGCTGCAAATAGATCATCGCCAGCACGACGAGGATCGGCGAGACTACGCAAAG
GCGCTGGCCAAGGCCGAGCTCAAGGTCAAAAATCTCGAGGAAGGGCAGTCGGCGCAGGAGCAGGCTCAGGCAAAG
CACGCGGCCGAGCTGGAATCGGTCAAGGCAGACATTGCGGCCAAGGAAAAGGAGCTGGCCAAGATACTGCCCCAA
TTCGCCAAGACGAAACGGGACGAAGACGAGATCAGACGGCAGCTGGACGCGGCCGAGGCCTCGAGGGCCCGTCTC
TTCGCCAAGCAGACCCGCGGCTCTCGATTTAAGAACAAGGCCGAGAGAGATGCATGGCTGAGGCAGGAGATCAAC
GAGCTCGACCAAACCATCAGCGCCCAAAAAGCAAATAAGCTCGAGGCCGAAGAAGAGGTCGCGAGAGTCCAGGCC
GCCATCAGCGAGAGCGAGCAGGAACTCGCCGACCTCCGGTCGCGCCTCGCCAACTGGAGCGGCGAGAGGAACCAA
CTCGCCGAGCAGGTCTCGCAGGCGAGGCTCACCCTCGACAAGCTCAACGACGAACGGAAGCTCATCCGCCGCGAG
GACGACAAGCTCGGCTCCGTCATCGCGAATGCCAGACAAGAGAAGGAGAAGGCGGAGCGCGAGCTGGCCCAATCC
GTCGACGGCGCGACAGCTCGTGGTCTGGCCACGCTCCGCCGCCTGCGGCAGGAACAGGACATCCCCGGCGCCTAC
GGCACACTGGCCGACCTGCTCACCGTCAGTGACGCCTATCGGCTGCCTGCCGAACAGACGGCGGGCGCGAGCCTG
TTCCACTACGTCGTCGACAACGCCGACACGGCAACATACCTGGCCGACATCCTTCACAGGCAGCGCGGTGGCCGA
ATCACCTTTATGCCGCTCGCACAGCTGCGTCCGCGCCATGTCAACCTGCCGAGAACCAACGACGCGGTGCCGCTG
ATAAGTAAAATCACCTACGACGCCAAGTTCGACAAGGCGTTTCGACAGGTCTTTGGAAAGACGGTCGTGTGTCCA
AATCTGACGGTGGCCGGCCAATACGCCAGGAGCCACGGCATCAATGGCATCACGGCCGAGGGAGACACGACCAAC
AAGAGAGGCGCCATGACAGGCGGATGGATCGATCCTCGCAAGTCGCGGCTGGAGGCCGTACAAGCGGCCAACAGG
TGGCGCCAGGAATACGACAAGCTGCTTTCTCGGTCGCGCGAAATCCGGAGCCAGATCGAGGGCAAAGACCAGGAG
ATTACCGCGGCCATGTCCGAGGTGCAGAAGCTCGAGCAGAGGCTGCGGCAGGCCGACGACGGCTTCGAGCCGCTC
AAGCACGAGCTCATGAGCAAGTCGGCGCACTTGGAAAACGAGCGGACCCATCTCGACGCGGCCATGAAACGACGC
GATGCCGTCGAGAAGAACATGAACGGCTTCATGGAGGAGGTTGCAGCGCACGAAGCCGAGATGGGCACCGAGTTC
AAGAAGAGCCTGACGGCGGCCCAAGAGCAGCAACTGGAAGAGCTGAGCGTGACGGTGCAGCAGCTCCAGAAGCAG
TGGAACGACATGAGCGACGGCCGCAGAAAGCTGGAGAAGTCGAAGCAGCTCCTCGAGGTCGACCTGCGCCAGAAT
CTCCAGATGAAGCTCGACCAACTCAACAGCCAGGCCTTTGAGAACTCGGCATCCTCAGCGTCGATCGGGGGGCTA
AAGGAGGCTCGGAGGGAGCTAAAAAAGGCGCAAAAGGCGCAGCAGGCCGTCGAGGCCAGCCTCGAGGAAGTCGAG
GGTAAGATGGAAGAGCTCAACAACCGGATGGAGCAGGTATCGGGCGAGAAAGCGGAGCGAGAGCAGACGCTGAGC
GAGATCTCGTCCAAGATAGAGAAGCAGCAGAAGAGGATGGAGAAGACGCTGCAGCGCAAAGCGCTTCTGACGGCG
CAGGCGGCAGAGTGTGCCAAGAATATCCGCGAACTCGGGATGCTTCCAGAGGAGGCCTTTGACAAGTACGAGAAC
ATGGAGGCGAAAGTGATCACGTCGAAGCTCAAGCGGGTCAACGAGGCGGTGAAGAAGTACAAGCACGTCAACAAA
AAGGCGTTTGAGCAGTACAACAACTTTACGTCGCAGCAGGACCACCTGATGAAGCGGCGCAAGGAGCTGGACGCG
TCGCAGGAGTCCATCGAGGAGCTTGTCGAGCACCTGGACCGACGAAAGGACGAGGCGATAGAGCGGACCTTCAAA
CAGGTGTCGCGTGAGTTTGCGACGATATTTGGCAAGCTGGTGCCGGCCGGTCATGGCCGGCTCGTCATTCAGCGC
CGGACAGACCGCCGCCAAGAGGCGGACGAGTCGGACGAGGAGGCGAGGGGAAGCGTTGAGAATTATACTGGCGTC
GGCATCAGCGTCTCCTTTAATTCGAAGCATCTGGACGAGCAGCAGAAGATTCAGCAGCTCAGCGGAGGCCAGAAG
AGTCTGTGCGCGCTCTGTCTCATCTTCGCGCTACAGGCGACAGAGAGCAGTCCGATGGTCATCTTCGACGAGGTG
GACGCCAACCTTGACGCCCAATACCGCACCGCCGTCGCGTCCCTGCTCGAGTCCATCTCCAACGAGATCGGGACG
CAATTCATCTGCACCACCTTCCGGCCCGAGATCGTCCACGTGGCCGACAAGTGCTACGGCGTCACGTTCCGCAAC
AAGACGAGTGGCATCAGCTGCGTCAGCACAGAAGACGCCCTCAACTTTGTCGAGGGACAGGCCAAGCCGGCTTGA
Gene >Ophio5|6891
ATGGGAGGCACTCTTCTAGGCAGAAATAGTGGGGCATCCAGACGCGACTTTCTAAGCGCCTGCTTAATCGCCGCG
GCGGCGCACGCGTCGCAGCGCATCGCCGCCCACGAGCAAGAAATTCAACGCCCCTCTGATGTCGCGCCGCCGACG
ATGTATATCAAGCAGATAATCATCCAGGGCTTCAAAAGGTGCGTCTGAGCTACCCTCTTGCCTGGGGCGCCACTG
ACCAATAGCTGCAGCTACAAAGACCAGACCGTCATCGAGCCCTTCTCGCCAAAGACAAACGTCATCGTCGGTCGC
AATGGCTCCGGCAAGAGCAACTTCTTCGCCGCCATGCGCTTCGTTCTCAGTGATGCCTATACCCAGATGAACCGC
GAGGAACGACAGGGTCTGCTGCATGAGGGCTCTGGATCAGCCGTCTTGTCGGCTTACGTCGAGATCATCTTCGAC
AACAGCGACGATCGCTTCCCCACGGGCGGAAAAGAGGTTATACTACGGCGCACGATTGGTCTCAAGAAGGATGAG
TACTCGGTCGATCGCAAGGTCGTCACAAAAAACGACGTCATGAACTTGCTCGAGGCGGCGGGCTTTTCGCGCTCC
AACCCCTACTACATCGTGCCCCAGGGACGCGTCACCGCCTTGACCAACATGAAGGAGTCAGACAGGCTGAACCTG
CTCAAGGAGGTGGCCGGCACCCACGTGTACGAGACGCGTCGAGCCGAGTCGCTCAAGATCATGAACGAGACCAAC
AACAAGCGGGAAAAGATCGACGAGCTGCTAGAGTACATCAAGGAGAGGCTTACCGAGCTGGAGGAGGAGAAGGAA
GAGCTCCGCGGATTCCAAGAAAAGGACCGTGAGAGACGGTGTCTCGAATACGCCTACCACCACAATGAACAAATG
ACGATCCAGTCCACCCTCGAGGACATAGACAACGCCAGGCAGGATGGGCTCGACACCACGGACTCAAGCCGATCC
GAGTTGGTCGAGGGTGAAAAGGCTCTCGCCAAATTGGACGCCGAAATGCACCAGCTGCAGCGCGACCTCGAGATG
CTGCAAATAGATCATCGCCAGCACGACGAGGATCGGCGAGACTACGCAAAGGCGCTGGCCAAGGCCGAGCTCAAG
GTCAAAAATCTCGAGGAAGGGCAGTCGGCGCAGGAGCAGGCTCAGGCAAAGCACGCGGCCGAGCTGGAATCGGTC
AAGGCAGACATTGCGGCCAAGGAAAAGGAGCTGGCCAAGATACTGCCCCAATTCGCCAAGACGAAACGGGACGAA
GACGAGATCAGACGGCAGCTGGACGCGGCCGAGGCCTCGAGGGCCCGTCTCTTCGCCAAGCAGACCCGCGGCTCT
CGATTTAAGAACAAGGCCGAGAGAGATGCATGGCTGAGGCAGGAGATCAACGAGCTCGACCAAACCATCAGCGCC
CAAAAAGCAAATAAGCTCGAGGCCGAAGAAGAGGTCGCGAGAGTCCAGGCCGCCATCAGCGAGAGCGAGCAGGAA
CTCGCCGACCTCCGGTCGCGCCTCGCCAACTGGAGCGGCGAGAGGAACCAACTCGCCGAGCAGGTCTCGCAGGCG
AGGCTCACCCTCGACAAGCTCAACGACGAACGGAAGCTCATCCGCCGCGAGGACGACAAGCTCGGCTCCGTCATC
GCGAATGCCAGACAAGAGAAGGAGAAGGCGGAGCGCGAGCTGGCCCAATCCGTCGACGGCGCGACAGCTCGTGGT
CTGGCCACGCTCCGCCGCCTGCGGCAGGAACAGGACATCCCCGGCGCCTACGGCACACTGGCCGACCTGCTCACC
GTCAGTGACGCCTATCGGCTGCCTGCCGAACAGACGGCGGGCGCGAGCCTGTTCCACTACGTCGTCGACAACGCC
GACACGGCAACATACCTGGCCGACATCCTTCACAGGCAGCGCGGTGGCCGAATCACCTTTATGCCGCTCGCACAG
CTGCGTCCGCGCCATGTCAACCTGCCGAGAACCAACGACGCGGTGCCGCTGATAAGTAAAATCACCTACGACGCC
AAGTTCGACAAGGCGTTTCGACAGGTCTTTGGAAAGACGGTCGTGTGTCCAAATCTGACGGTGGCCGGCCAATAC
GCCAGGAGCCACGGCATCAATGGCATCACGGCCGAGGGAGACACGACCAACAAGAGAGGCGCCATGACAGGCGGA
TGGATCGATCCTCGCAAGTCGCGGCTGGAGGCCGTACAAGCGGCCAACAGGTGGCGCCAGGAATACGACAAGCTG
CTTTCTCGGTCGCGCGAAATCCGGAGCCAGATCGAGGGCAAAGACCAGGAGATTACCGCGGCCATGTCCGAGGTG
CAGAAGCTCGAGCAGAGGCTGCGGCAGGCCGACGACGGCTTCGAGCCGCTCAAGCACGAGCTCATGAGCAAGTCG
GCGCACTTGGAAAACGAGCGGACCCATCTCGACGCGGCCATGAAACGACGCGATGCCGTCGAGAAGAACATGAAC
GGCTTCATGGAGGAGGTTGCAGCGCACGAAGCCGAGATGGGCACCGAGTTCAAGAAGAGCCTGACGGCGGCCCAA
GAGCAGCAACTGGAAGAGCTGAGCGTGACGGTGCAGCAGCTCCAGAAGCAGTGGAACGACATGAGCGACGGCCGC
AGAAAGCTGGAGAAGTCGAAGCAGCTCCTCGAGGTCGACCTGCGCCAGAATCTCCAGATGAAGCTCGACCAACTC
AACAGCCAGGCCTTTGAGAACTCGGCATCCTCAGCGTCGATCGGGGGGCTAAAGGAGGCTCGGAGGGAGCTAAAA
AAGGCGCAAAAGGCGCAGCAGGCCGTCGAGGCCAGCCTCGAGGAAGTCGAGGGTAAGATGGAAGAGCTCAACAAC
CGGATGGAGCAGGTATCGGGCGAGAAAGCGGAGCGAGAGCAGACGCTGAGCGAGATCTCGTCCAAGATAGAGAAG
CAGCAGAAGAGGATGGAGAAGACGCTGCAGCGCAAAGCGCTTCTGACGGCGCAGGCGGCAGAGTGTGCCAAGAAT
ATCCGCGAACTCGGGATGCTTCCAGAGGAGGCCTTTGACAAGTACGAGAACATGGAGGCGAAAGTGGTGCGTCGG
CCGGCCCCCCCCCCCCTTTTTTTTTCGGTTGTCTGTTACAAGATGAGAGATGTGTGCTAAGCCGACCTCACAGAT
CACGTCGAAGCTCAAGCGGGTCAACGAGGCGGTGAAGAAGTACAAGCACGTCAACAAAAAGGCGTTTGAGCAGTA
CAACAACTTTACGTCGCAGCAGGACCACCTGATGAAGCGGCGCAAGGAGCTGGACGCGTCGCAGGAGTCCATCGA
GGAGCTTGTCGAGCACCTGGACCGACGAAAGGACGAGGCGATAGAGCGGACCTTCAAACAGGTGTCGCGTGAGTT
TGCGACGATATTTGGCAAGCTGGTGCCGGCCGGTCATGGCCGGCTCGTCATTCAGCGCCGGACAGACCGCCGCCA
AGAGGCGGACGAGTCGGACGAGGAGGCGAGGGGAAGCGTTGAGAATTATACTGGCGTCGGCATCAGCGTCTCCTT
TAATTCGAAGCATCTGGACGAGCAGCAGAAGATTCAGCAGCTCAGCGGAGGCCAGAAGAGTAGGTGTTCCCCTTG
TCCCAATTTTTTTTTTTCCCTTCCCCCCCCCCCCCCCCTCGTCGTCGATCAATGTGCTGTTCTGTGAAAGCGGCT
TTCTTTGCTAACGAGTCCAGGTCTGTGCGCGCTCTGTCTCATCTTCGCGCTACAGGCGACAGAGAGCAGTCCGAT
GGTCATCTTCGACGAGGTGGACGCCAACCTTGACGCCCAATACCGCACCGCCGTCGCGTCCCTGCTCGAGTCCAT
CTCCAACGAGATCGGGACGCAATTCATCTGCACCACCTTCCGGCCCGAGATCGTCCACGTGGCCGACAAGTGCTA
CGGCGTCACGTTCCGCAACAAGACGAGTGGCATCAGCTGCGTCAGCACAGAAGACGCCCTCAACTTTGTCGAGGG
ACAGGCCAAGCCGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail