Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6885
Gene name
Locationscaffold_625:62..372
Strand-
Gene length (bp)310
Transcript length (bp)246
Coding sequence length (bp)243
Protein length (aa) 81

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12400 STIMATE STIMATE family 1.3E-07 36 76

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 35.98 4.28 67.68
CcL In ants, during behavior modification 58.35 13.72 102.99
CcD In ants, recently dead 47.55 10.37 84.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.266111 no
SC16a CcD 0.544669 no
CcL CcD 0.647083 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6885
MSMLTSGRFDIIRPEPATQRLLVRDSDPDSYTPNPCSFYLLNLAIDTTVGIPILIILLRILTGLAAMTPLGKPAE
SLLSGN
Coding >Ophio5|6885
ATGTCCATGTTGACCAGTGGTCGCTTCGATATCATACGTCCTGAACCAGCAACGCAGCGTTTGTTGGTTCGCGAC
TCTGACCCGGACTCGTACACGCCCAACCCTTGTTCCTTTTACCTCCTTAACCTCGCCATCGATACCACCGTCGGC
ATTCCCATCCTCATCATCCTACTACGCATCCTCACGGGCCTCGCGGCCATGACACCCCTTGGCAAGCCGGCCGAG
TCGCTCCTCTCGGGAAAC
Transcript >Ophio5|6885
ATGTCCATGTTGACCAGTGGTCGCTTCGATATCATACGTCCTGAACCAGCAACGCAGCGTTTGTTGGTTCGCGAC
TCTGACCCGGACTCGTACACGCCCAACCCTTGTTCCTTTTACCTCCTTAACCTCGCCATCGATACCACCGTCGGC
ATTCCCATCCTCATCATCCTACTACGCATCCTCACGGGCCTCGCGGCCATGACACCCCTTGGCAAGCCGGCCGAG
TCGCTCCTCTCGGGAAACTAG
Gene >Ophio5|6885
ATGTCCATGTTGACCAGTGGTCGCTTCGATATCATACGTCCTGAACCAGCAACGCAGCGTTTGTTGGTTCGCGAC
TCTGACCCGGACTCGTACACGCCCAACCCTTGTTCCTTTTACCTCCTTAACCTCGCCATCGATGTGAGTTTGACA
GCCTTTTTTTTTTTTTTTTTTTTTTCCTTTTTTTTTTTTAACCAGATTCCAGACCACCGTCGGCATTCCCATCCT
CATCATCCTACTACGCATCCTCACGGGCCTCGCGGCCATGACACCCCTTGGCAAGCCGGCCGAGTCGCTCCTCTC
GGGAAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail