Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6881
Gene name
Locationscaffold_624:2509..4418
Strand-
Gene length (bp)1909
Transcript length (bp)1845
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 2.6E-75 162 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 19 592 9.0E-121
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 21 595 7.0E-112
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 48 586 2.0E-94
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 85 543 6.0E-34
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 81 558 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 19 592 9.0E-121
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 21 595 7.0E-112
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 48 586 2.0E-94
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 85 543 6.0E-34
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 81 558 1.0E-30
sp|P46032|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1 85 539 1.0E-30
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 85 558 3.0E-30
sp|Q9LFB8|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana GN=NPF8.2 PE=2 SV=1 52 534 8.0E-30
sp|Q91W98|S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus GN=Slc15a4 PE=1 SV=1 81 558 9.0E-30
sp|P36836|S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus GN=SLC15A1 PE=2 SV=1 77 477 1.0E-29
sp|Q8N697|S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens GN=SLC15A4 PE=2 SV=1 81 532 2.0E-29
sp|Q84WG0|PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana GN=NPF8.4 PE=2 SV=2 85 576 3.0E-29
sp|Q93Z20|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana GN=NPF8.5 PE=2 SV=1 19 543 4.0E-28
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 77 467 4.0E-27
sp|P51574|S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus GN=Slc15a1 PE=2 SV=1 77 467 1.0E-26
sp|P46059|S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens GN=SLC15A1 PE=2 SV=1 77 467 2.0E-26
sp|Q9JIP7|S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus GN=Slc15a1 PE=1 SV=2 77 467 3.0E-26
sp|A6QQL0|S15A4_BOVIN Solute carrier family 15 member 4 OS=Bos taurus GN=SLC15A4 PE=2 SV=2 81 532 3.0E-26
sp|Q9ES07|S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus GN=Slc15a2 PE=1 SV=1 80 462 2.0E-24
sp|P46029|S15A2_RABIT Solute carrier family 15 member 2 OS=Oryctolagus cuniculus GN=SLC15A2 PE=2 SV=1 80 467 3.0E-24
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 80 462 1.0E-23
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 76 495 7.0E-23
sp|Q16348|S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens GN=SLC15A2 PE=2 SV=2 80 467 1.0E-21
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 80 432 9.0E-21
sp|Q9FNL8|PTR4_ARATH Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana GN=NPF5.3 PE=2 SV=1 53 539 2.0E-19
sp|Q9LVE0|PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4 OS=Arabidopsis thaliana GN=NPF6.4 PE=1 SV=1 46 540 3.0E-19
sp|Q0WSZ6|PTR23_ARATH Protein NRT1/ PTR FAMILY 5.13 OS=Arabidopsis thaliana GN=NPF5.13 PE=2 SV=2 48 534 3.0E-19
sp|Q924V4|S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus GN=Slc15a3 PE=2 SV=1 249 554 8.0E-19
sp|Q9FNL7|PTR3_ARATH Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana GN=NPF5.2 PE=2 SV=1 53 545 1.0E-18
sp|Q17758|PEPT2_CAEEL Peptide transporter family 2 OS=Caenorhabditis elegans GN=pept-2 PE=1 SV=2 46 474 2.0E-17
sp|Q8BPX9|S15A3_MOUSE Solute carrier family 15 member 3 OS=Mus musculus GN=Slc15a3 PE=2 SV=1 249 554 5.0E-17
sp|Q9SK99|PTR11_ARATH Protein NRT1/ PTR FAMILY 5.15 OS=Arabidopsis thaliana GN=NPF5.15 PE=2 SV=1 77 552 1.0E-16
sp|Q8IY34|S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=2 81 554 4.0E-16
sp|O01840|PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans GN=pept-3 PE=1 SV=1 85 459 5.0E-16
sp|Q9M1I2|PTR46_ARATH Protein NRT1/ PTR FAMILY 5.4 OS=Arabidopsis thaliana GN=NPF5.4 PE=2 SV=1 81 528 5.0E-16
sp|Q8VZE2|PTR22_ARATH Protein NRT1/ PTR FAMILY 5.14 OS=Arabidopsis thaliana GN=NPF5.14 PE=2 SV=2 47 539 8.0E-16
sp|Q0WP01|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10 OS=Arabidopsis thaliana GN=NPF5.10 PE=2 SV=1 54 534 1.0E-15
sp|Q9C7U1|PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12 OS=Arabidopsis thaliana GN=NPF5.12 PE=2 SV=1 54 539 2.0E-15
sp|Q9FM20|PTR54_ARATH Protein NRT1/ PTR FAMILY 4.7 OS=Arabidopsis thaliana GN=NPF4.7 PE=2 SV=2 122 548 3.0E-15
sp|P0CI03|PTR28_ARATH Protein NRT1/ PTR FAMILY 5.6 OS=Arabidopsis thaliana GN=NPF5.6 PE=2 SV=1 52 542 7.0E-15
sp|Q9M331|PTR45_ARATH Protein NRT1/ PTR FAMILY 5.7 OS=Arabidopsis thaliana GN=NPF5.7 PE=2 SV=2 52 542 7.0E-15
sp|Q8VYE4|PTR12_ARATH Protein NRT1/ PTR FAMILY 4.5 OS=Arabidopsis thaliana GN=NPF4.5 PE=2 SV=1 187 552 9.0E-15
sp|Q9SRI2|PTR31_ARATH Protein NRT1/ PTR FAMILY 5.9 OS=Arabidopsis thaliana GN=NPF5.9 PE=2 SV=1 143 553 9.0E-15
sp|Q9LQL2|PTR14_ARATH Protein NRT1/ PTR FAMILY 7.3 OS=Arabidopsis thaliana GN=NPF7.3 PE=1 SV=2 145 539 1.0E-14
sp|Q3E9B5|PTR51_ARATH Protein NRT1/ PTR FAMILY 7.1 OS=Arabidopsis thaliana GN=NPF7.1 PE=2 SV=1 145 550 2.0E-14
sp|Q8RX77|PTR21_ARATH Protein NRT1/ PTR FAMILY 2.13 OS=Arabidopsis thaliana GN=NPF2.13 PE=1 SV=1 143 587 5.0E-14
sp|Q9LFR1|PTR50_ARATH Protein NRT1/ PTR FAMILY 5.8 OS=Arabidopsis thaliana GN=NPF5.8 PE=2 SV=1 143 548 6.0E-14
sp|Q9SK96|PTR10_ARATH Protein NRT1/ PTR FAMILY 5.16 OS=Arabidopsis thaliana GN=NPF5.16 PE=2 SV=1 77 534 2.0E-13
sp|Q9M9V7|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9 OS=Arabidopsis thaliana GN=NPF2.9 PE=1 SV=1 149 532 3.0E-11
sp|Q8H157|PTR19_ARATH Protein NRT1/ PTR FAMILY 4.6 OS=Arabidopsis thaliana GN=NPF4.6 PE=1 SV=1 155 533 1.0E-10
sp|Q8RX67|PTR24_ARATH Protein NRT1/ PTR FAMILY 5.11 OS=Arabidopsis thaliana GN=NPF5.11 PE=2 SV=1 51 534 4.0E-10
sp|Q9SX20|PTR18_ARATH Protein NRT1/ PTR FAMILY 3.1 OS=Arabidopsis thaliana GN=NPF3.1 PE=2 SV=1 53 540 5.0E-10
sp|Q05085|PTR7_ARATH Protein NRT1/ PTR FAMILY 6.3 OS=Arabidopsis thaliana GN=NPF6.3 PE=1 SV=1 54 548 6.0E-10
sp|Q9LFX9|PTR13_ARATH Protein NRT1/ PTR FAMILY 2.12 OS=Arabidopsis thaliana GN=NPF2.12 PE=1 SV=2 139 577 7.0E-10
sp|Q9SZY4|PTR27_ARATH Protein NRT1/ PTR FAMILY 6.2 OS=Arabidopsis thaliana GN=NPF6.2 PE=1 SV=1 54 540 2.0E-09
sp|Q8VZR7|PTR30_ARATH Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana GN=NPF5.1 PE=2 SV=2 85 298 1.0E-07
sp|Q9LSF0|PTR34_ARATH Protein NRT1/ PTR FAMILY 4.1 OS=Arabidopsis thaliana GN=NPF4.1 PE=2 SV=1 130 528 1.0E-06
sp|Q3E8X3|PTR52_ARATH Protein NRT1/ PTR FAMILY 2.8 OS=Arabidopsis thaliana GN=NPF2.8 PE=2 SV=2 136 319 2.0E-06
sp|P39276|DTPC_ECOLI Dipeptide and tripeptide permease C OS=Escherichia coli (strain K12) GN=dtpC PE=1 SV=1 77 304 5.0E-06
sp|Q7NRM5|DTPA_CHRVO Dipeptide and tripeptide permease A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dtpA PE=3 SV=1 84 296 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 162 184 22
3 194 216 22
4 250 272 22
5 276 298 22
6 370 392 22
7 407 429 22
8 441 463 22
9 492 514 22
10 527 546 19
11 556 578 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6881
MASAVNIDHDVITQVGLVEHKALGVKDNNIVTATEPVDLSKGSFAGLSSTSEDDYDGRPTDEEMKSLRRVSGKIM
WSMWTIAFVELCERFSYYGTSVLYTNFINHPLPQGSRTGAPVHAGDLPGALGMGPKAAQGLTLFNMFFAYMMPLV
GAWVADARMGRFWTLHLAIGISTIAHVVLVVAASPGVLANNKASFGVFIVGLLVLCVGTGFFKANVSPLLAEQND
DVRPRVEVRKGERVIVDPAVTNTRIFLYFYFCINVGSLTGQIGMVYVEKYVGFWVAFLIPTALFLLAPFVLGSQK
KSYKLKPPTGSLLSKFFRMFFFVRRRSSFTSFDWNVAKPSNVPVGQRPSWMTYDDAWVDEVRRGLKACKVFLFLP
IFFLSYNQMTGNLTIQAGTMELHGVPNDIIQNLNPISILLIIPVIDHIIYPTLRKMGFAFTPIKRMTTGFIIAAL
SMVASAVMQYYIYQKSPCGWYANKTLVVDGQKKPCPPAPINVWAQCLPYIFIGIAEVLANVTSYEYAFSKAPENM
KSLVMSVNLFMSAISAALGQAFTPLSDDPLLVWNYTVVAVIAFAGGAAFWLCFRHLDSEEDKLNMLKKSEFIGDQ
KPGLTKAQEAGEDV
Coding >Ophio5|6881
ATGGCGAGCGCCGTCAACATCGACCACGATGTCATCACCCAAGTCGGGCTGGTCGAGCACAAGGCGCTCGGCGTC
AAGGACAACAACATCGTGACGGCGACGGAGCCCGTCGACCTCTCCAAGGGGTCTTTCGCCGGCCTCTCGTCCACC
TCGGAAGATGACTACGATGGTCGTCCGACGGACGAGGAGATGAAGTCGCTGCGGCGTGTGTCTGGAAAGATCATG
TGGAGCATGTGGACCATCGCCTTCGTCGAGCTTTGCGAACGCTTCTCCTACTATGGCACCTCGGTCCTTTATACA
AACTTCATCAACCATCCGCTTCCCCAGGGGTCCAGGACGGGCGCCCCCGTTCATGCGGGAGACCTCCCCGGGGCG
CTCGGCATGGGCCCAAAGGCGGCTCAGGGCCTGACGCTGTTTAACATGTTCTTTGCCTACATGATGCCGCTGGTC
GGCGCTTGGGTGGCCGACGCTCGTATGGGCCGCTTCTGGACGCTTCATCTGGCCATTGGCATCTCGACCATCGCC
CACGTCGTCCTCGTCGTCGCCGCCTCGCCCGGCGTCCTGGCCAACAACAAGGCCTCTTTCGGAGTCTTCATCGTC
GGCCTACTGGTCCTTTGCGTCGGCACCGGCTTCTTCAAGGCCAACGTGTCGCCGCTCCTGGCCGAGCAAAACGAC
GATGTACGGCCCAGAGTCGAGGTCCGCAAAGGCGAACGCGTCATCGTCGATCCGGCCGTGACAAACACTCGCATC
TTCCTCTACTTTTACTTTTGCATCAACGTCGGCTCCCTCACCGGTCAGATCGGCATGGTCTATGTTGAAAAGTAC
GTCGGATTTTGGGTCGCCTTCCTGATTCCTACCGCCCTCTTCCTCCTGGCTCCCTTCGTGCTCGGTTCGCAGAAG
AAGAGCTACAAGCTCAAGCCGCCGACTGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCTTCTTCGTCCGCAGG
CGCTCCTCCTTCACCTCGTTCGACTGGAACGTGGCCAAGCCGTCCAACGTACCCGTCGGTCAGAGACCGTCGTGG
ATGACGTACGACGACGCTTGGGTGGACGAGGTTCGCCGCGGTCTCAAGGCCTGCAAGGTCTTCCTCTTCCTCCCC
ATCTTCTTCCTCTCCTATAACCAGATGACGGGCAACCTCACCATCCAGGCCGGTACCATGGAGCTGCACGGCGTG
CCCAACGACATCATCCAGAACCTCAACCCCATCTCTATCCTCCTCATCATCCCCGTCATCGACCACATCATCTAC
CCGACGCTGCGGAAGATGGGTTTCGCCTTTACCCCCATCAAGCGCATGACGACGGGCTTCATCATCGCTGCCCTG
TCCATGGTCGCCTCGGCGGTGATGCAGTATTACATTTACCAAAAGAGCCCCTGCGGCTGGTACGCCAACAAGACT
CTCGTCGTCGACGGTCAGAAGAAGCCGTGTCCGCCGGCTCCCATCAATGTCTGGGCGCAGTGTCTGCCCTACATC
TTCATCGGCATTGCCGAGGTGCTGGCCAATGTGACGTCGTACGAGTACGCCTTCTCCAAGGCGCCCGAGAACATG
AAGTCTCTCGTCATGAGCGTCAACCTATTTATGAGCGCCATCTCTGCCGCCCTCGGCCAGGCCTTTACTCCGCTA
TCCGACGACCCGCTGTTGGTCTGGAACTACACCGTCGTCGCAGTCATTGCCTTTGCCGGAGGCGCCGCCTTTTGG
CTCTGCTTCCGCCACCTCGACTCGGAGGAGGACAAGCTGAATATGCTCAAGAAGTCCGAGTTCATCGGCGATCAG
AAGCCCGGACTGACAAAGGCCCAGGAAGCGGGCGAGGACGTA
Transcript >Ophio5|6881
ATGGCGAGCGCCGTCAACATCGACCACGATGTCATCACCCAAGTCGGGCTGGTCGAGCACAAGGCGCTCGGCGTC
AAGGACAACAACATCGTGACGGCGACGGAGCCCGTCGACCTCTCCAAGGGGTCTTTCGCCGGCCTCTCGTCCACC
TCGGAAGATGACTACGATGGTCGTCCGACGGACGAGGAGATGAAGTCGCTGCGGCGTGTGTCTGGAAAGATCATG
TGGAGCATGTGGACCATCGCCTTCGTCGAGCTTTGCGAACGCTTCTCCTACTATGGCACCTCGGTCCTTTATACA
AACTTCATCAACCATCCGCTTCCCCAGGGGTCCAGGACGGGCGCCCCCGTTCATGCGGGAGACCTCCCCGGGGCG
CTCGGCATGGGCCCAAAGGCGGCTCAGGGCCTGACGCTGTTTAACATGTTCTTTGCCTACATGATGCCGCTGGTC
GGCGCTTGGGTGGCCGACGCTCGTATGGGCCGCTTCTGGACGCTTCATCTGGCCATTGGCATCTCGACCATCGCC
CACGTCGTCCTCGTCGTCGCCGCCTCGCCCGGCGTCCTGGCCAACAACAAGGCCTCTTTCGGAGTCTTCATCGTC
GGCCTACTGGTCCTTTGCGTCGGCACCGGCTTCTTCAAGGCCAACGTGTCGCCGCTCCTGGCCGAGCAAAACGAC
GATGTACGGCCCAGAGTCGAGGTCCGCAAAGGCGAACGCGTCATCGTCGATCCGGCCGTGACAAACACTCGCATC
TTCCTCTACTTTTACTTTTGCATCAACGTCGGCTCCCTCACCGGTCAGATCGGCATGGTCTATGTTGAAAAGTAC
GTCGGATTTTGGGTCGCCTTCCTGATTCCTACCGCCCTCTTCCTCCTGGCTCCCTTCGTGCTCGGTTCGCAGAAG
AAGAGCTACAAGCTCAAGCCGCCGACTGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCTTCTTCGTCCGCAGG
CGCTCCTCCTTCACCTCGTTCGACTGGAACGTGGCCAAGCCGTCCAACGTACCCGTCGGTCAGAGACCGTCGTGG
ATGACGTACGACGACGCTTGGGTGGACGAGGTTCGCCGCGGTCTCAAGGCCTGCAAGGTCTTCCTCTTCCTCCCC
ATCTTCTTCCTCTCCTATAACCAGATGACGGGCAACCTCACCATCCAGGCCGGTACCATGGAGCTGCACGGCGTG
CCCAACGACATCATCCAGAACCTCAACCCCATCTCTATCCTCCTCATCATCCCCGTCATCGACCACATCATCTAC
CCGACGCTGCGGAAGATGGGTTTCGCCTTTACCCCCATCAAGCGCATGACGACGGGCTTCATCATCGCTGCCCTG
TCCATGGTCGCCTCGGCGGTGATGCAGTATTACATTTACCAAAAGAGCCCCTGCGGCTGGTACGCCAACAAGACT
CTCGTCGTCGACGGTCAGAAGAAGCCGTGTCCGCCGGCTCCCATCAATGTCTGGGCGCAGTGTCTGCCCTACATC
TTCATCGGCATTGCCGAGGTGCTGGCCAATGTGACGTCGTACGAGTACGCCTTCTCCAAGGCGCCCGAGAACATG
AAGTCTCTCGTCATGAGCGTCAACCTATTTATGAGCGCCATCTCTGCCGCCCTCGGCCAGGCCTTTACTCCGCTA
TCCGACGACCCGCTGTTGGTCTGGAACTACACCGTCGTCGCAGTCATTGCCTTTGCCGGAGGCGCCGCCTTTTGG
CTCTGCTTCCGCCACCTCGACTCGGAGGAGGACAAGCTGAATATGCTCAAGAAGTCCGAGTTCATCGGCGATCAG
AAGCCCGGACTGACAAAGGCCCAGGAAGCGGGCGAGGACGTATGA
Gene >Ophio5|6881
ATGGCGAGCGCCGTCAACATCGACCACGATGTCATCACCCAAGTCGGGCTGGTCGAGCACAAGGCGCTCGGCGTC
AAGGACAACAACATCGTGACGGCGACGGAGCCCGTCGACCTCTCCAAGGGGTCTTTCGCCGGCCTCTCGTCCACC
TCGGAAGATGACTACGATGGTCGTCCGACGGACGAGGAGATGAAGTCGCTGCGGCGTGTGTCTGGAAAGATCATG
TGGAGCATGTGGACCATCGCCTTCGTCGAGCTTTGCGAACGCTTCTCCTACTATGGCACCTCGGTCCTTTATACA
AACTTCATCAACCATCCGCTTCCCCAGGGGTCCAGGACGGGCGCCCCCGTTCATGCGGGAGACCTCCCCGGGGCG
CTCGGCATGGGCCCAAAGGCGGCTCAGGGCCTGACGCTGTTTAACATGTTCTTTGCCTACATGATGCCGCTGGTC
GGGTGAGTGGACGCTCGGCTCGGCTGCTTTCTCTGTTCCTGAGCTGACGATGAGGGTCCAATGCAGCGCTTGGGT
GGCCGACGCTCGTATGGGCCGCTTCTGGACGCTTCATCTGGCCATTGGCATCTCGACCATCGCCCACGTCGTCCT
CGTCGTCGCCGCCTCGCCCGGCGTCCTGGCCAACAACAAGGCCTCTTTCGGAGTCTTCATCGTCGGCCTACTGGT
CCTTTGCGTCGGCACCGGCTTCTTCAAGGCCAACGTGTCGCCGCTCCTGGCCGAGCAAAACGACGATGTACGGCC
CAGAGTCGAGGTCCGCAAAGGCGAACGCGTCATCGTCGATCCGGCCGTGACAAACACTCGCATCTTCCTCTACTT
TTACTTTTGCATCAACGTCGGCTCCCTCACCGGTCAGATCGGCATGGTCTATGTTGAAAAGTACGTCGGATTTTG
GGTCGCCTTCCTGATTCCTACCGCCCTCTTCCTCCTGGCTCCCTTCGTGCTCGGTTCGCAGAAGAAGAGCTACAA
GCTCAAGCCGCCGACTGGCTCGCTGCTGTCCAAGTTCTTCCGCATGTTCTTCTTCGTCCGCAGGCGCTCCTCCTT
CACCTCGTTCGACTGGAACGTGGCCAAGCCGTCCAACGTACCCGTCGGTCAGAGACCGTCGTGGATGACGTACGA
CGACGCTTGGGTGGACGAGGTTCGCCGCGGTCTCAAGGCCTGCAAGGTCTTCCTCTTCCTCCCCATCTTCTTCCT
CTCCTATAACCAGATGACGGGCAACCTCACCATCCAGGCCGGTACCATGGAGCTGCACGGCGTGCCCAACGACAT
CATCCAGAACCTCAACCCCATCTCTATCCTCCTCATCATCCCCGTCATCGACCACATCATCTACCCGACGCTGCG
GAAGATGGGTTTCGCCTTTACCCCCATCAAGCGCATGACGACGGGCTTCATCATCGCTGCCCTGTCCATGGTCGC
CTCGGCGGTGATGCAGTATTACATTTACCAAAAGAGCCCCTGCGGCTGGTACGCCAACAAGACTCTCGTCGTCGA
CGGTCAGAAGAAGCCGTGTCCGCCGGCTCCCATCAATGTCTGGGCGCAGTGTCTGCCCTACATCTTCATCGGCAT
TGCCGAGGTGCTGGCCAATGTGACGTCGTACGAGTACGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGT
CATGAGCGTCAACCTATTTATGAGCGCCATCTCTGCCGCCCTCGGCCAGGCCTTTACTCCGCTATCCGACGACCC
GCTGTTGGTCTGGAACTACACCGTCGTCGCAGTCATTGCCTTTGCCGGAGGCGCCGCCTTTTGGCTCTGCTTCCG
CCACCTCGACTCGGAGGAGGACAAGCTGAATATGCTCAAGAAGTCCGAGTTCATCGGCGATCAGAAGCCCGGACT
GACAAAGGCCCAGGAAGCGGGCGAGGACGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail