Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6880
Gene name
Locationscaffold_624:1072..2322
Strand+
Gene length (bp)1250
Transcript length (bp)1086
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-11 5 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 1 354 4.0E-33
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 1 346 3.0E-18
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 165 334 8.0E-10
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 50 282 5.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 128 283 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 1 354 4.0E-33
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 1 346 3.0E-18
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 165 334 8.0E-10
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 50 282 5.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 128 283 2.0E-06
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 192 282 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 41 60 19
3 140 162 22
4 182 204 22
5 225 247 22
6 257 279 22
7 286 305 19
8 320 342 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6880
MFFVHQRGTANGVYLIAFSAGSFVVAMAAGAQAETFGWRSSYRTLAGAMTGLCLLILVGLEETKPLAVVMRGGGR
RQATAVDDIEPGIKLSVFDSPLSSPVCAQPPPGRRRPWPARLRLQWVTPTDESLWKLACQPFHSAWFPHVIFTSL
EYASGVCWLVVLCSVVSVVFSRPPYDFKAAPIGFIMFAGPLVGSLLGAVYGGWFSDWAVVRFARRNGGVLEPEMR
LWLLPLPAILMSGGLAVFGITADRGMHWIFPSIGSAIFVAGFGAVSDITFTLVIDAFPDIVPLTFVAVAFFRNSI
SIAGPFSITPWMEVMSVSGIFISGMALTFLVHLVAVPVVLWGKQFRARLAPRYYRLSDMAS
Coding >Ophio5|6880
ATGTTCTTCGTCCACCAGCGCGGCACGGCCAACGGAGTCTACCTCATCGCCTTCTCGGCCGGAAGCTTCGTCGTC
GCCATGGCTGCCGGTGCTCAGGCCGAAACTTTCGGCTGGCGGTCTTCCTACCGGACCCTGGCCGGCGCCATGACG
GGGCTCTGTCTGCTGATCCTCGTCGGTCTGGAGGAGACGAAGCCGTTGGCTGTGGTGATGCGAGGAGGAGGACGA
CGACAAGCTACGGCCGTCGACGATATCGAGCCCGGCATTAAGCTCAGCGTCTTCGATTCCCCCCTGTCCAGTCCC
GTCTGTGCCCAGCCCCCCCCGGGTCGACGACGACCCTGGCCGGCACGTCTTCGACTGCAGTGGGTGACGCCGACG
GACGAGTCCCTCTGGAAACTCGCCTGTCAGCCCTTTCACTCCGCCTGGTTCCCGCACGTCATCTTTACGTCTCTG
GAGTACGCTTCCGGCGTCTGCTGGCTCGTCGTTCTTTGCTCCGTCGTCTCCGTCGTCTTCTCCCGCCCACCATAT
GACTTCAAGGCCGCTCCCATCGGCTTCATCATGTTCGCGGGACCGCTGGTTGGCTCTCTCCTGGGCGCCGTCTAC
GGCGGCTGGTTCTCCGACTGGGCCGTGGTGCGCTTCGCGAGGCGTAATGGCGGCGTCTTGGAACCGGAGATGCGC
CTGTGGCTGCTGCCGCTTCCGGCCATCCTCATGTCCGGGGGGCTCGCCGTCTTTGGCATCACGGCTGATCGTGGC
ATGCACTGGATCTTTCCCAGTATCGGGTCCGCCATCTTCGTCGCCGGTTTCGGTGCCGTCTCCGACATCACTTTC
ACTCTCGTCATCGACGCCTTTCCGGATATTGTTCCCTTGACCTTTGTCGCCGTCGCCTTTTTTCGCAACAGCATC
AGCATCGCCGGCCCCTTTTCCATCACGCCGTGGATGGAGGTGATGAGCGTCAGCGGCATCTTCATCAGTGGCATG
GCCTTGACTTTTCTTGTCCACCTCGTCGCCGTGCCCGTCGTCTTATGGGGCAAGCAGTTCCGGGCTCGGCTCGCG
CCTCGATATTATCGTCTGTCGGACATGGCTAGC
Transcript >Ophio5|6880
ATGTTCTTCGTCCACCAGCGCGGCACGGCCAACGGAGTCTACCTCATCGCCTTCTCGGCCGGAAGCTTCGTCGTC
GCCATGGCTGCCGGTGCTCAGGCCGAAACTTTCGGCTGGCGGTCTTCCTACCGGACCCTGGCCGGCGCCATGACG
GGGCTCTGTCTGCTGATCCTCGTCGGTCTGGAGGAGACGAAGCCGTTGGCTGTGGTGATGCGAGGAGGAGGACGA
CGACAAGCTACGGCCGTCGACGATATCGAGCCCGGCATTAAGCTCAGCGTCTTCGATTCCCCCCTGTCCAGTCCC
GTCTGTGCCCAGCCCCCCCCGGGTCGACGACGACCCTGGCCGGCACGTCTTCGACTGCAGTGGGTGACGCCGACG
GACGAGTCCCTCTGGAAACTCGCCTGTCAGCCCTTTCACTCCGCCTGGTTCCCGCACGTCATCTTTACGTCTCTG
GAGTACGCTTCCGGCGTCTGCTGGCTCGTCGTTCTTTGCTCCGTCGTCTCCGTCGTCTTCTCCCGCCCACCATAT
GACTTCAAGGCCGCTCCCATCGGCTTCATCATGTTCGCGGGACCGCTGGTTGGCTCTCTCCTGGGCGCCGTCTAC
GGCGGCTGGTTCTCCGACTGGGCCGTGGTGCGCTTCGCGAGGCGTAATGGCGGCGTCTTGGAACCGGAGATGCGC
CTGTGGCTGCTGCCGCTTCCGGCCATCCTCATGTCCGGGGGGCTCGCCGTCTTTGGCATCACGGCTGATCGTGGC
ATGCACTGGATCTTTCCCAGTATCGGGTCCGCCATCTTCGTCGCCGGTTTCGGTGCCGTCTCCGACATCACTTTC
ACTCTCGTCATCGACGCCTTTCCGGATATTGTTCCCTTGACCTTTGTCGCCGTCGCCTTTTTTCGCAACAGCATC
AGCATCGCCGGCCCCTTTTCCATCACGCCGTGGATGGAGGTGATGAGCGTCAGCGGCATCTTCATCAGTGGCATG
GCCTTGACTTTTCTTGTCCACCTCGTCGCCGTGCCCGTCGTCTTATGGGGCAAGCAGTTCCGGGCTCGGCTCGCG
CCTCGATATTATCGTCTGTCGGACATGGCTAGCTAA
Gene >Ophio5|6880
ATGTTCTTCGTCCACCAGCGCGGCACGGCCAACGGAGTCTACCTCATCGCCTTCTCGGCCGGAAGCTTCGTCGTC
GCCATGGCTGCCGGTGCTCAGGCCGAAACTTTCGGCTGGCGGTCTTCCTACCGGACCCTGGCCGGCGCCATGACG
GGGCTCTGTCTGCTGATCCTCGTCGGTCTGGAGGAGACGAAGCCGTTGGCTGTGGTGATGCGAGGAGGAGGACGA
CGACAAGCTACGGCCGTCGACGATATCGAGCCCGGCATTAAGCTCAGCGTCTTCGATTCCCCCCTGTCCAGTCCC
GTCTGTGCCCAGCCCCCCCCGGGTCGACGACGACCCTGGCCGGCACGTCTTCGACTGCAGTGGGTGACGCCGACG
GACGAGTCCCTCTGGAAACTCGCCTGTCAGCCCTTTCACTCCGCCTGGTTCCCGCACGTCATCTTTACGTCTCTG
GAGTACGCTTCCGGCGTCTGCTGGCTCGTCGTTCTTTGCTCCGTCGTCTCCGTCGTCTTCTCCCGCCCACCATAT
GACTTCAAGGCCGCTCCCATCGGCTTCATCATGTTCGCGGGACCGCTGGTTGGCTCTCTCCTGGGCGCCGTCTAC
GGCGGCTGGTTCTCCGACTGGGCCGTGGTGCGCTTCGCGAGGCGTAATGGCGGCGTCTTGGAACCGGAGATGCGC
CTGTGGCTGCTGCCGCTTCCGGCCATCCTCATGTCCGGGGGGCTCGCCGTCTTTGGCATCACGGCTGATCGTGTA
CGTCTTTCTGTGCCCTTCCCTTCTCCCCTGCTTCTGCTTCTTGGGGGAATCAGAGCGCTTTCGGTTCGCTGACAG
GGTAGGGGGGGGTTTGCTCAGGGCATGCACTGGATCTTTCCCAGTATCGGGTCCGCCATCTTCGTCGCCGGTTTC
GGTGCCGTCTCCGACATCACTTTCACTCTCGTCATCGACGCCTTTCCGGATGTGAGTACTTTTCCCCAAAGAGGA
AAAAAAGGGGGCAGAGAAGGGAGATTGACAAACCAGCGCAGATTGTTCCCTTGACCTTTGTCGCCGTCGCCTTTT
TTCGCAACAGCATCAGCATCGCCGGCCCCTTTTCCATCACGCCGTGGATGGAGGTGATGAGCGTCAGCGGCATCT
TCATCAGTGGCATGGCCTTGACTTTTCTTGTCCACCTCGTCGCCGTGCCCGTCGTCTTATGGGGCAAGCAGTTCC
GGGCTCGGCTCGCGCCTCGATATTATCGTCTGTCGGACATGGCTAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail