Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6867
Gene name
Locationscaffold_620:8265..11145
Strand+
Gene length (bp)2880
Transcript length (bp)2880
Coding sequence length (bp)2877
Protein length (aa) 959

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CW63|ACRB_NEOFI Probable ubiquitination network signaling protein acrB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=acrB PE=3 SV=1 154 814 3.0E-76
sp|B0Y4N5|ACRB_ASPFC Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=acrB PE=3 SV=1 154 814 2.0E-74
sp|Q4WQG9|ACRB_ASPFU Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acrB PE=3 SV=1 154 814 2.0E-74
sp|Q0CT23|ACRB_ASPTN Probable ubiquitination network signaling protein acrB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=acrB PE=3 SV=1 1 814 3.0E-73
sp|A1CIK0|ACRB_ASPCL Probable ubiquitination network signaling protein acrB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=acrB PE=3 SV=1 154 813 3.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CW63|ACRB_NEOFI Probable ubiquitination network signaling protein acrB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=acrB PE=3 SV=1 154 814 3.0E-76
sp|B0Y4N5|ACRB_ASPFC Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=acrB PE=3 SV=1 154 814 2.0E-74
sp|Q4WQG9|ACRB_ASPFU Probable ubiquitination network signaling protein acrB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acrB PE=3 SV=1 154 814 2.0E-74
sp|Q0CT23|ACRB_ASPTN Probable ubiquitination network signaling protein acrB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=acrB PE=3 SV=1 1 814 3.0E-73
sp|A1CIK0|ACRB_ASPCL Probable ubiquitination network signaling protein acrB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=acrB PE=3 SV=1 154 813 3.0E-72
sp|Q876Q0|ACRB_EMENI Ubiquitination network signaling protein acrB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acrB PE=3 SV=1 130 814 4.0E-72
sp|A2Q9L8|ACRB_ASPNC Probable ubiquitination network signaling protein acrB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=acrB PE=3 SV=2 154 814 3.0E-71
sp|Q2UUI0|ACRB_ASPOR Probable ubiquitination network signaling protein acrB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=acrB PE=3 SV=2 154 814 7.0E-71
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 180 202 22
2 223 245 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 54.33 29.00 79.65
CcL In ants, during behavior modification 92.10 43.71 140.50
CcD In ants, recently dead 62.25 32.96 91.53

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.028518 yes
SC16a CcD 0.601376 no
CcL CcD 0.120705 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6867
MPRASSSGKRQLGSGRDARQDHGLVGSGRRISAATKGCSYLNGPSVCSDSYASLPQPPPPPSPPSPLLPPPSLAP
NGLVNGAHHQVKKRPDDATVPPGLDLRPGHALRRRSLDAYSETSSESCLSSLGPGLDGGHRQIDVNAMKNADVHR
DSGPLDLAITVVRSLPIQDTLAILIILMHVPYLSLTLVYACFASLTFVPPVANRAGWNINFGEIFDGNSHTPSLA
TVVCMDFFFFLIWVFLWPPIQDSILEFAKPVIAVTLGGGTNAKDGTSQGVTACFAWVLIHKLVRALRRYWPRLAY
HLPDAWRVRAVLGGSLPTATTTTTTSTAAALHAPYDKRDTHGWIQSVLAIHILTQGIVRYIREWYLRRERFHTAA
GPGDPEAGKSSAAAGAGASHAAGASESTHDTTLNTPDFETTPIAPSPHPVGLTKKRRKQSAQVRLQQPLWAALAS
TKIVAMKEIELSSWGSGSSDKRDIHNAGNAPSFDRQPRQIWISYIGSDEVCFSTSHFPDECDDEPSKTSSTRPAG
VDTTKPFYVRINNAFWQPTRIFPVGDDGGGLRWTGDIYGLRPASKYVCEFVHLQTDQVLFTTSIRTVKEPLRDRD
VSSPGQPNGQQPLRPDSPATTLRTSIEAAEAKLADEKNRLKTWRKEWKARINTLKKENELAENQLASAGNNDERF
KQKIRQQETQKAQTERDTCHLSEKAKHLDEAGPELVERKKQAERAFSADKRVYDAAQKEFKEHKSQLAKDVKAKE
AEKSNLIARRNKIATRIAKIENELASIVDSNSRGKGEAERRRQDRCRWLEQVSAVEHGYSDRLAQQVAVNNRKRE
HVRELQAQLKSMQGYMKPANGMKMEGEAATFRRTSPWNASPMAAANYPWAASSPDVLASRTASMTARLPPPALTG
FDTRGAKARVRSSSLLSDVSGFTQASDEGTRHRAQPSLVVRRNGSSGSSGSGGSMGDGN
Coding >Ophio5|6867
ATGCCTCGAGCGTCGAGCTCGGGCAAGCGACAGCTGGGCTCCGGCCGCGACGCGAGGCAAGATCATGGGCTTGTA
GGCTCTGGAAGGCGCATCTCGGCCGCCACCAAGGGCTGCAGCTACCTCAACGGACCGTCCGTCTGCTCCGACAGC
TATGCCTCTCTGCCTCAGCCACCGCCGCCGCCCTCGCCGCCCTCGCCGCTGCTGCCACCACCTTCGCTTGCCCCC
AACGGTCTTGTCAACGGTGCCCATCATCAAGTCAAGAAACGGCCCGACGATGCCACCGTTCCGCCTGGCCTCGAT
CTCCGACCAGGTCATGCCCTCCGCAGGCGCTCGCTCGACGCCTACTCCGAGACCTCGTCCGAGTCGTGCCTCTCG
AGCCTGGGCCCAGGTCTCGACGGTGGCCATCGACAAATCGACGTCAATGCAATGAAGAACGCCGACGTTCACCGC
GACTCGGGGCCCCTTGACCTTGCCATCACCGTCGTTCGCTCTCTGCCCATCCAGGACACGCTCGCCATACTCATC
ATTCTCATGCACGTACCCTATCTCTCCCTGACTCTGGTCTATGCCTGCTTCGCCTCCCTCACCTTCGTCCCGCCC
GTCGCCAATAGGGCCGGCTGGAACATCAACTTTGGTGAAATATTCGACGGCAACTCGCACACGCCTTCGCTCGCG
ACCGTCGTCTGCATGGATTTCTTCTTCTTTCTCATCTGGGTCTTTCTGTGGCCGCCCATCCAGGACTCGATTCTC
GAGTTCGCCAAGCCCGTCATTGCCGTCACTCTCGGTGGTGGCACCAACGCCAAGGACGGCACCTCGCAAGGCGTT
ACCGCCTGCTTCGCCTGGGTCCTAATTCACAAGCTCGTTCGTGCCTTGAGGCGTTACTGGCCTCGCCTAGCATAC
CACTTACCCGACGCATGGCGTGTGCGTGCCGTATTGGGCGGTTCCCTCCCGACGGCTACGACAACGACGACGACA
TCTACTGCTGCCGCCCTTCATGCGCCGTACGATAAGAGAGACACGCACGGGTGGATTCAGAGTGTCCTCGCCATC
CACATACTCACCCAAGGCATCGTCAGGTATATCCGAGAGTGGTATCTGCGGCGCGAACGGTTCCACACCGCGGCC
GGCCCAGGCGATCCAGAAGCGGGCAAGTCTTCGGCGGCTGCGGGCGCGGGCGCGTCCCACGCAGCGGGCGCGAGT
GAGTCGACCCATGACACCACCTTGAACACTCCCGATTTCGAGACGACGCCTATCGCTCCCTCACCCCATCCCGTC
GGCTTGACAAAGAAACGGAGAAAGCAGAGTGCCCAGGTGCGTCTGCAGCAGCCGCTCTGGGCGGCGCTTGCGAGC
ACCAAGATCGTCGCCATGAAGGAGATTGAGCTCTCCAGCTGGGGCAGCGGCAGCTCCGACAAGCGAGACATTCAC
AACGCCGGAAACGCCCCGTCTTTTGATCGGCAGCCGAGGCAGATCTGGATCTCGTACATCGGTAGCGACGAGGTC
TGCTTCAGCACCAGCCACTTCCCGGACGAGTGCGACGACGAGCCTTCCAAGACCAGCAGCACCAGACCTGCCGGC
GTGGACACGACGAAGCCCTTTTATGTCAGGATCAATAACGCCTTTTGGCAGCCCACGCGCATTTTCCCCGTCGGA
GACGACGGCGGCGGGCTCCGATGGACTGGTGACATTTACGGCTTGCGTCCGGCGTCCAAGTACGTGTGCGAATTC
GTGCATCTTCAGACGGACCAGGTCCTGTTCACGACCAGCATCCGCACGGTCAAGGAGCCCCTGCGCGATCGTGAC
GTGTCCTCGCCCGGGCAGCCCAACGGCCAGCAGCCGTTGCGCCCCGACTCGCCCGCCACGACGCTCCGGACCTCG
ATCGAGGCCGCCGAGGCCAAGCTCGCCGACGAAAAGAACCGGCTCAAGACGTGGCGCAAGGAGTGGAAGGCCCGC
ATCAACACGCTGAAGAAGGAGAACGAGCTGGCTGAAAATCAGCTCGCGTCGGCGGGCAACAACGACGAGCGGTTC
AAGCAAAAGATCCGGCAGCAGGAGACGCAAAAGGCTCAGACGGAGCGGGACACTTGCCATCTCTCAGAGAAGGCT
AAGCATCTAGACGAGGCCGGGCCCGAGCTCGTTGAGCGGAAGAAGCAGGCAGAACGGGCTTTTTCGGCCGATAAG
AGGGTGTATGACGCGGCGCAAAAGGAGTTCAAGGAGCACAAGTCGCAGCTTGCCAAGGACGTCAAGGCCAAAGAG
GCGGAGAAGTCGAACCTCATTGCTCGGCGCAACAAGATTGCGACTCGGATTGCCAAGATTGAAAATGAGCTGGCA
AGCATCGTCGACTCCAACAGCCGCGGCAAGGGCGAGGCGGAGCGCCGCCGTCAGGATAGATGCAGGTGGCTGGAG
CAGGTGTCGGCCGTCGAGCACGGCTACTCGGATCGACTGGCACAGCAGGTGGCAGTCAACAACAGGAAAAGGGAA
CATGTGCGCGAGCTACAGGCACAGCTGAAGTCGATGCAGGGCTACATGAAGCCGGCCAACGGGATGAAGATGGAA
GGGGAGGCGGCGACGTTTCGGCGGACGAGCCCGTGGAACGCAAGCCCCATGGCGGCGGCCAACTACCCCTGGGCG
GCTTCTTCGCCGGACGTGCTGGCGTCTCGGACGGCCAGCATGACAGCGCGGCTGCCCCCTCCGGCTTTGACTGGC
TTCGACACTCGCGGCGCAAAGGCTCGGGTCAGGAGCTCGAGTCTGCTTAGCGATGTGAGCGGCTTCACCCAGGCC
AGCGACGAGGGCACGCGACACCGAGCTCAGCCGTCGCTGGTCGTGCGGAGGAATGGCAGCAGTGGCAGTAGCGGC
AGCGGGGGCAGCATGGGCGATGGCAAC
Transcript >Ophio5|6867
ATGCCTCGAGCGTCGAGCTCGGGCAAGCGACAGCTGGGCTCCGGCCGCGACGCGAGGCAAGATCATGGGCTTGTA
GGCTCTGGAAGGCGCATCTCGGCCGCCACCAAGGGCTGCAGCTACCTCAACGGACCGTCCGTCTGCTCCGACAGC
TATGCCTCTCTGCCTCAGCCACCGCCGCCGCCCTCGCCGCCCTCGCCGCTGCTGCCACCACCTTCGCTTGCCCCC
AACGGTCTTGTCAACGGTGCCCATCATCAAGTCAAGAAACGGCCCGACGATGCCACCGTTCCGCCTGGCCTCGAT
CTCCGACCAGGTCATGCCCTCCGCAGGCGCTCGCTCGACGCCTACTCCGAGACCTCGTCCGAGTCGTGCCTCTCG
AGCCTGGGCCCAGGTCTCGACGGTGGCCATCGACAAATCGACGTCAATGCAATGAAGAACGCCGACGTTCACCGC
GACTCGGGGCCCCTTGACCTTGCCATCACCGTCGTTCGCTCTCTGCCCATCCAGGACACGCTCGCCATACTCATC
ATTCTCATGCACGTACCCTATCTCTCCCTGACTCTGGTCTATGCCTGCTTCGCCTCCCTCACCTTCGTCCCGCCC
GTCGCCAATAGGGCCGGCTGGAACATCAACTTTGGTGAAATATTCGACGGCAACTCGCACACGCCTTCGCTCGCG
ACCGTCGTCTGCATGGATTTCTTCTTCTTTCTCATCTGGGTCTTTCTGTGGCCGCCCATCCAGGACTCGATTCTC
GAGTTCGCCAAGCCCGTCATTGCCGTCACTCTCGGTGGTGGCACCAACGCCAAGGACGGCACCTCGCAAGGCGTT
ACCGCCTGCTTCGCCTGGGTCCTAATTCACAAGCTCGTTCGTGCCTTGAGGCGTTACTGGCCTCGCCTAGCATAC
CACTTACCCGACGCATGGCGTGTGCGTGCCGTATTGGGCGGTTCCCTCCCGACGGCTACGACAACGACGACGACA
TCTACTGCTGCCGCCCTTCATGCGCCGTACGATAAGAGAGACACGCACGGGTGGATTCAGAGTGTCCTCGCCATC
CACATACTCACCCAAGGCATCGTCAGGTATATCCGAGAGTGGTATCTGCGGCGCGAACGGTTCCACACCGCGGCC
GGCCCAGGCGATCCAGAAGCGGGCAAGTCTTCGGCGGCTGCGGGCGCGGGCGCGTCCCACGCAGCGGGCGCGAGT
GAGTCGACCCATGACACCACCTTGAACACTCCCGATTTCGAGACGACGCCTATCGCTCCCTCACCCCATCCCGTC
GGCTTGACAAAGAAACGGAGAAAGCAGAGTGCCCAGGTGCGTCTGCAGCAGCCGCTCTGGGCGGCGCTTGCGAGC
ACCAAGATCGTCGCCATGAAGGAGATTGAGCTCTCCAGCTGGGGCAGCGGCAGCTCCGACAAGCGAGACATTCAC
AACGCCGGAAACGCCCCGTCTTTTGATCGGCAGCCGAGGCAGATCTGGATCTCGTACATCGGTAGCGACGAGGTC
TGCTTCAGCACCAGCCACTTCCCGGACGAGTGCGACGACGAGCCTTCCAAGACCAGCAGCACCAGACCTGCCGGC
GTGGACACGACGAAGCCCTTTTATGTCAGGATCAATAACGCCTTTTGGCAGCCCACGCGCATTTTCCCCGTCGGA
GACGACGGCGGCGGGCTCCGATGGACTGGTGACATTTACGGCTTGCGTCCGGCGTCCAAGTACGTGTGCGAATTC
GTGCATCTTCAGACGGACCAGGTCCTGTTCACGACCAGCATCCGCACGGTCAAGGAGCCCCTGCGCGATCGTGAC
GTGTCCTCGCCCGGGCAGCCCAACGGCCAGCAGCCGTTGCGCCCCGACTCGCCCGCCACGACGCTCCGGACCTCG
ATCGAGGCCGCCGAGGCCAAGCTCGCCGACGAAAAGAACCGGCTCAAGACGTGGCGCAAGGAGTGGAAGGCCCGC
ATCAACACGCTGAAGAAGGAGAACGAGCTGGCTGAAAATCAGCTCGCGTCGGCGGGCAACAACGACGAGCGGTTC
AAGCAAAAGATCCGGCAGCAGGAGACGCAAAAGGCTCAGACGGAGCGGGACACTTGCCATCTCTCAGAGAAGGCT
AAGCATCTAGACGAGGCCGGGCCCGAGCTCGTTGAGCGGAAGAAGCAGGCAGAACGGGCTTTTTCGGCCGATAAG
AGGGTGTATGACGCGGCGCAAAAGGAGTTCAAGGAGCACAAGTCGCAGCTTGCCAAGGACGTCAAGGCCAAAGAG
GCGGAGAAGTCGAACCTCATTGCTCGGCGCAACAAGATTGCGACTCGGATTGCCAAGATTGAAAATGAGCTGGCA
AGCATCGTCGACTCCAACAGCCGCGGCAAGGGCGAGGCGGAGCGCCGCCGTCAGGATAGATGCAGGTGGCTGGAG
CAGGTGTCGGCCGTCGAGCACGGCTACTCGGATCGACTGGCACAGCAGGTGGCAGTCAACAACAGGAAAAGGGAA
CATGTGCGCGAGCTACAGGCACAGCTGAAGTCGATGCAGGGCTACATGAAGCCGGCCAACGGGATGAAGATGGAA
GGGGAGGCGGCGACGTTTCGGCGGACGAGCCCGTGGAACGCAAGCCCCATGGCGGCGGCCAACTACCCCTGGGCG
GCTTCTTCGCCGGACGTGCTGGCGTCTCGGACGGCCAGCATGACAGCGCGGCTGCCCCCTCCGGCTTTGACTGGC
TTCGACACTCGCGGCGCAAAGGCTCGGGTCAGGAGCTCGAGTCTGCTTAGCGATGTGAGCGGCTTCACCCAGGCC
AGCGACGAGGGCACGCGACACCGAGCTCAGCCGTCGCTGGTCGTGCGGAGGAATGGCAGCAGTGGCAGTAGCGGC
AGCGGGGGCAGCATGGGCGATGGCAACTGA
Gene >Ophio5|6867
ATGCCTCGAGCGTCGAGCTCGGGCAAGCGACAGCTGGGCTCCGGCCGCGACGCGAGGCAAGATCATGGGCTTGTA
GGCTCTGGAAGGCGCATCTCGGCCGCCACCAAGGGCTGCAGCTACCTCAACGGACCGTCCGTCTGCTCCGACAGC
TATGCCTCTCTGCCTCAGCCACCGCCGCCGCCCTCGCCGCCCTCGCCGCTGCTGCCACCACCTTCGCTTGCCCCC
AACGGTCTTGTCAACGGTGCCCATCATCAAGTCAAGAAACGGCCCGACGATGCCACCGTTCCGCCTGGCCTCGAT
CTCCGACCAGGTCATGCCCTCCGCAGGCGCTCGCTCGACGCCTACTCCGAGACCTCGTCCGAGTCGTGCCTCTCG
AGCCTGGGCCCAGGTCTCGACGGTGGCCATCGACAAATCGACGTCAATGCAATGAAGAACGCCGACGTTCACCGC
GACTCGGGGCCCCTTGACCTTGCCATCACCGTCGTTCGCTCTCTGCCCATCCAGGACACGCTCGCCATACTCATC
ATTCTCATGCACGTACCCTATCTCTCCCTGACTCTGGTCTATGCCTGCTTCGCCTCCCTCACCTTCGTCCCGCCC
GTCGCCAATAGGGCCGGCTGGAACATCAACTTTGGTGAAATATTCGACGGCAACTCGCACACGCCTTCGCTCGCG
ACCGTCGTCTGCATGGATTTCTTCTTCTTTCTCATCTGGGTCTTTCTGTGGCCGCCCATCCAGGACTCGATTCTC
GAGTTCGCCAAGCCCGTCATTGCCGTCACTCTCGGTGGTGGCACCAACGCCAAGGACGGCACCTCGCAAGGCGTT
ACCGCCTGCTTCGCCTGGGTCCTAATTCACAAGCTCGTTCGTGCCTTGAGGCGTTACTGGCCTCGCCTAGCATAC
CACTTACCCGACGCATGGCGTGTGCGTGCCGTATTGGGCGGTTCCCTCCCGACGGCTACGACAACGACGACGACA
TCTACTGCTGCCGCCCTTCATGCGCCGTACGATAAGAGAGACACGCACGGGTGGATTCAGAGTGTCCTCGCCATC
CACATACTCACCCAAGGCATCGTCAGGTATATCCGAGAGTGGTATCTGCGGCGCGAACGGTTCCACACCGCGGCC
GGCCCAGGCGATCCAGAAGCGGGCAAGTCTTCGGCGGCTGCGGGCGCGGGCGCGTCCCACGCAGCGGGCGCGAGT
GAGTCGACCCATGACACCACCTTGAACACTCCCGATTTCGAGACGACGCCTATCGCTCCCTCACCCCATCCCGTC
GGCTTGACAAAGAAACGGAGAAAGCAGAGTGCCCAGGTGCGTCTGCAGCAGCCGCTCTGGGCGGCGCTTGCGAGC
ACCAAGATCGTCGCCATGAAGGAGATTGAGCTCTCCAGCTGGGGCAGCGGCAGCTCCGACAAGCGAGACATTCAC
AACGCCGGAAACGCCCCGTCTTTTGATCGGCAGCCGAGGCAGATCTGGATCTCGTACATCGGTAGCGACGAGGTC
TGCTTCAGCACCAGCCACTTCCCGGACGAGTGCGACGACGAGCCTTCCAAGACCAGCAGCACCAGACCTGCCGGC
GTGGACACGACGAAGCCCTTTTATGTCAGGATCAATAACGCCTTTTGGCAGCCCACGCGCATTTTCCCCGTCGGA
GACGACGGCGGCGGGCTCCGATGGACTGGTGACATTTACGGCTTGCGTCCGGCGTCCAAGTACGTGTGCGAATTC
GTGCATCTTCAGACGGACCAGGTCCTGTTCACGACCAGCATCCGCACGGTCAAGGAGCCCCTGCGCGATCGTGAC
GTGTCCTCGCCCGGGCAGCCCAACGGCCAGCAGCCGTTGCGCCCCGACTCGCCCGCCACGACGCTCCGGACCTCG
ATCGAGGCCGCCGAGGCCAAGCTCGCCGACGAAAAGAACCGGCTCAAGACGTGGCGCAAGGAGTGGAAGGCCCGC
ATCAACACGCTGAAGAAGGAGAACGAGCTGGCTGAAAATCAGCTCGCGTCGGCGGGCAACAACGACGAGCGGTTC
AAGCAAAAGATCCGGCAGCAGGAGACGCAAAAGGCTCAGACGGAGCGGGACACTTGCCATCTCTCAGAGAAGGCT
AAGCATCTAGACGAGGCCGGGCCCGAGCTCGTTGAGCGGAAGAAGCAGGCAGAACGGGCTTTTTCGGCCGATAAG
AGGGTGTATGACGCGGCGCAAAAGGAGTTCAAGGAGCACAAGTCGCAGCTTGCCAAGGACGTCAAGGCCAAAGAG
GCGGAGAAGTCGAACCTCATTGCTCGGCGCAACAAGATTGCGACTCGGATTGCCAAGATTGAAAATGAGCTGGCA
AGCATCGTCGACTCCAACAGCCGCGGCAAGGGCGAGGCGGAGCGCCGCCGTCAGGATAGATGCAGGTGGCTGGAG
CAGGTGTCGGCCGTCGAGCACGGCTACTCGGATCGACTGGCACAGCAGGTGGCAGTCAACAACAGGAAAAGGGAA
CATGTGCGCGAGCTACAGGCACAGCTGAAGTCGATGCAGGGCTACATGAAGCCGGCCAACGGGATGAAGATGGAA
GGGGAGGCGGCGACGTTTCGGCGGACGAGCCCGTGGAACGCAAGCCCCATGGCGGCGGCCAACTACCCCTGGGCG
GCTTCTTCGCCGGACGTGCTGGCGTCTCGGACGGCCAGCATGACAGCGCGGCTGCCCCCTCCGGCTTTGACTGGC
TTCGACACTCGCGGCGCAAAGGCTCGGGTCAGGAGCTCGAGTCTGCTTAGCGATGTGAGCGGCTTCACCCAGGCC
AGCGACGAGGGCACGCGACACCGAGCTCAGCCGTCGCTGGTCGTGCGGAGGAATGGCAGCAGTGGCAGTAGCGGC
AGCGGGGGCAGCATGGGCGATGGCAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail