Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6851
Gene name
Locationscaffold_62:29301..31481
Strand-
Gene length (bp)2180
Transcript length (bp)2010
Coding sequence length (bp)2007
Protein length (aa) 669

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09825 BPL_N Biotin-protein ligase, N terminal 6.5E-110 7 285
PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family 1.7E-19 403 546

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48445|BPL1_YEAST Biotin--protein ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPL1 PE=1 SV=1 6 668 2.0E-127
sp|O14353|BPL1_SCHPO Biotin--protein ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpl1 PE=3 SV=1 6 669 2.0E-111
sp|Q920N2|BPL1_MOUSE Biotin--protein ligase OS=Mus musculus GN=Hlcs PE=1 SV=1 7 668 1.0E-39
sp|P50747|BPL1_HUMAN Biotin--protein ligase OS=Homo sapiens GN=HLCS PE=1 SV=1 214 668 3.0E-38
sp|F4I4W2|HCS2_ARATH Biotin--protein ligase 2 OS=Arabidopsis thaliana GN=HCS2 PE=2 SV=1 397 668 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48445|BPL1_YEAST Biotin--protein ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPL1 PE=1 SV=1 6 668 2.0E-127
sp|O14353|BPL1_SCHPO Biotin--protein ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpl1 PE=3 SV=1 6 669 2.0E-111
sp|Q920N2|BPL1_MOUSE Biotin--protein ligase OS=Mus musculus GN=Hlcs PE=1 SV=1 7 668 1.0E-39
sp|P50747|BPL1_HUMAN Biotin--protein ligase OS=Homo sapiens GN=HLCS PE=1 SV=1 214 668 3.0E-38
sp|F4I4W2|HCS2_ARATH Biotin--protein ligase 2 OS=Arabidopsis thaliana GN=HCS2 PE=2 SV=1 397 668 1.0E-34
sp|Q9SL92|HCS1_ARATH Biotin--protein ligase 1, chloroplastic OS=Arabidopsis thaliana GN=HCS1 PE=1 SV=2 397 668 3.0E-34
sp|Q9PL03|Y305_CHLMU Uncharacterized protein TC_0305 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0305 PE=3 SV=1 8 225 1.0E-25
sp|O84038|Y035_CHLTR Uncharacterized protein CT_035 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_035 PE=3 SV=1 8 229 5.0E-25
sp|Q9Z953|Y128_CHLPN Uncharacterized protein CPn_0128/CP_0643/CPj0128/CpB0130 OS=Chlamydia pneumoniae GN=CPn_0128 PE=3 SV=1 5 225 3.0E-20
sp|P37416|BIRA_SALTY Bifunctional ligase/repressor BirA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=birA PE=3 SV=2 406 598 2.0E-08
sp|P46363|BIRA_HAEIN Bifunctional ligase/repressor BirA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=birA PE=3 SV=1 403 619 4.0E-07
sp|P06709|BIRA_ECOLI Bifunctional ligase/repressor BirA OS=Escherichia coli (strain K12) GN=birA PE=1 SV=1 406 598 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0036211 protein modification process Yes
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043412 macromolecule modification No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5655 0.7043 0.0688 0.0222 0.1163 0.0093 0.0991 0.271 0.3874 0.0058

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3359
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7535
Ophiocordyceps australis map64 (Brazil) OphauB2|6975
Ophiocordyceps camponoti-floridani Ophcf2|01097
Ophiocordyceps camponoti-rufipedis Ophun1|251
Ophiocordyceps kimflemingae Ophio5|6851 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6248

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6851
MAQRRLNVLVFTGTGTSAESVRQCLYSLRRLLSPDYAVIPVGEAALLKEPWPSTCALLVFPGGADLGYCRVFNGA
GNRRIHDFVRRGGAYLGLCAGGYYGSARCEFEVGHPPLDVVGPRELAFFPAACRGAAFSGFRYDSEMGARAASLC
VNTAFFDAPVPKSFASYYNGGGVFVDAAHLDAGHVHVLASYADELDVDGGHGRAAVVLCDVGDGKAVLCGPHPEF
AAVNLHPQPDIPWYADLISKLAAHDQARVSFLRACLVSLGLEVGLQQAPVPPLSHLHLSSCDGAKVADILCAWDD
ILSKEQGHEVIRGEADTFLIWSHQDGLNLDELSDALPHSPEPAIGDDGQADFTTIPKSIIAHEHDPPSPESTPHF
DHALFYANLARFQAIEPDATDWGSILLYGEVVTSTNSLLEKNSKLTTRLPTGFTFSASTQLAGRGRGTNSWIAPP
GALMFSTTINHPAHLAVSRPAIFLQYIAAIAVVEAVQSLGAGYEKLPIKLKWPNDIYALDPTKPAALRQYVKIGG
VLSHCGYCDGQYQVVLGIGVNATNPRPTTALSDLLPAGAAPLRLEVLLARILTRLEAVHAQFLRHGFSEDLERRY
YRHWLHTGQAISLEAEGGIRARVLGITRDWGMLRAEETDAEGRGTGKIWSLQSDENSFDFWKGLVRRKT
Coding >Ophio5|6851
ATGGCGCAGCGGCGTCTCAACGTGCTCGTCTTCACTGGCACCGGCACCAGCGCCGAGTCGGTGCGGCAATGCCTT
TACTCGCTACGCCGACTGTTATCGCCCGATTACGCCGTCATCCCCGTCGGCGAAGCGGCGCTGCTCAAGGAGCCG
TGGCCGTCTACGTGCGCGCTGCTCGTCTTCCCCGGAGGCGCCGATCTCGGCTATTGTCGCGTCTTCAACGGCGCC
GGCAACCGTCGGATCCACGACTTTGTCCGGCGCGGCGGCGCGTACCTCGGCCTCTGTGCCGGAGGTTATTACGGC
AGTGCGCGATGCGAGTTTGAGGTCGGACATCCGCCGCTCGATGTCGTCGGCCCTCGTGAGCTGGCCTTCTTTCCC
GCTGCCTGTCGCGGCGCTGCCTTCTCCGGCTTTCGCTATGACAGCGAGATGGGAGCGCGAGCGGCTAGCCTCTGC
GTCAATACGGCCTTCTTTGACGCTCCCGTGCCAAAGTCGTTTGCCTCTTATTATAACGGTGGTGGCGTCTTTGTT
GATGCCGCTCACCTCGATGCTGGCCATGTCCATGTCTTGGCCTCGTACGCCGACGAGCTCGACGTGGATGGCGGC
CATGGCCGCGCTGCTGTTGTCCTCTGTGACGTCGGAGATGGAAAAGCTGTTCTCTGCGGGCCGCATCCCGAGTTT
GCCGCCGTCAATCTTCATCCCCAGCCCGACATCCCCTGGTATGCCGACCTCATCAGCAAGCTTGCCGCCCATGAC
CAGGCTCGCGTCAGCTTCTTGAGGGCCTGTCTTGTCAGTCTCGGCCTGGAGGTAGGCCTACAGCAGGCGCCTGTC
CCCCCCCTATCTCACCTGCACCTCTCTTCCTGCGACGGTGCCAAGGTGGCCGATATCCTCTGCGCCTGGGATGAC
ATCTTGTCCAAGGAGCAAGGCCACGAGGTCATCAGGGGCGAGGCAGACACCTTTCTCATCTGGTCCCATCAAGAC
GGCCTCAACCTCGACGAGCTCTCTGACGCTCTCCCACACTCGCCGGAACCAGCCATCGGAGACGATGGTCAGGCC
GATTTCACCACGATCCCCAAGAGCATAATCGCCCACGAGCACGACCCGCCAAGCCCCGAGTCGACACCTCACTTC
GATCACGCACTCTTTTATGCCAATCTGGCGCGCTTTCAAGCCATTGAGCCCGACGCCACCGACTGGGGCAGCATC
CTGCTGTACGGCGAGGTGGTGACGAGCACCAACTCCCTTCTGGAAAAAAACTCCAAGTTGACCACCAGGCTGCCA
ACGGGCTTCACCTTTTCAGCCTCAACGCAGCTCGCAGGTCGTGGCCGCGGCACCAACTCCTGGATAGCGCCCCCT
GGAGCTCTCATGTTCTCGACCACCATCAACCACCCGGCACATCTTGCCGTCTCGCGTCCGGCCATATTCCTGCAG
TACATTGCCGCCATCGCCGTCGTCGAGGCCGTCCAGTCGCTGGGCGCGGGCTACGAGAAGCTACCGATAAAGCTC
AAGTGGCCCAACGACATCTACGCCCTCGACCCGACCAAGCCGGCCGCGCTGCGCCAGTACGTCAAGATCGGAGGC
GTCCTCTCCCATTGCGGCTACTGCGACGGCCAGTATCAAGTCGTGCTCGGCATCGGCGTCAACGCTACCAACCCG
CGTCCTACGACAGCCCTCTCGGATCTGCTGCCCGCGGGCGCCGCGCCTCTTCGGCTTGAGGTGCTCTTGGCCCGC
ATTCTCACTCGTCTCGAGGCCGTTCACGCGCAGTTCCTGCGACACGGCTTTTCCGAGGATTTGGAGCGACGGTAT
TATCGTCACTGGCTACACACGGGTCAGGCCATCTCTCTCGAGGCCGAGGGCGGGATACGTGCCCGTGTGCTCGGC
ATCACCAGGGATTGGGGCATGCTGCGTGCGGAGGAGACTGACGCAGAGGGAAGGGGCACGGGCAAGATTTGGAGC
CTTCAGAGCGATGAGAACAGCTTCGATTTCTGGAAGGGTCTGGTCCGACGGAAGACC
Transcript >Ophio5|6851
ATGGCGCAGCGGCGTCTCAACGTGCTCGTCTTCACTGGCACCGGCACCAGCGCCGAGTCGGTGCGGCAATGCCTT
TACTCGCTACGCCGACTGTTATCGCCCGATTACGCCGTCATCCCCGTCGGCGAAGCGGCGCTGCTCAAGGAGCCG
TGGCCGTCTACGTGCGCGCTGCTCGTCTTCCCCGGAGGCGCCGATCTCGGCTATTGTCGCGTCTTCAACGGCGCC
GGCAACCGTCGGATCCACGACTTTGTCCGGCGCGGCGGCGCGTACCTCGGCCTCTGTGCCGGAGGTTATTACGGC
AGTGCGCGATGCGAGTTTGAGGTCGGACATCCGCCGCTCGATGTCGTCGGCCCTCGTGAGCTGGCCTTCTTTCCC
GCTGCCTGTCGCGGCGCTGCCTTCTCCGGCTTTCGCTATGACAGCGAGATGGGAGCGCGAGCGGCTAGCCTCTGC
GTCAATACGGCCTTCTTTGACGCTCCCGTGCCAAAGTCGTTTGCCTCTTATTATAACGGTGGTGGCGTCTTTGTT
GATGCCGCTCACCTCGATGCTGGCCATGTCCATGTCTTGGCCTCGTACGCCGACGAGCTCGACGTGGATGGCGGC
CATGGCCGCGCTGCTGTTGTCCTCTGTGACGTCGGAGATGGAAAAGCTGTTCTCTGCGGGCCGCATCCCGAGTTT
GCCGCCGTCAATCTTCATCCCCAGCCCGACATCCCCTGGTATGCCGACCTCATCAGCAAGCTTGCCGCCCATGAC
CAGGCTCGCGTCAGCTTCTTGAGGGCCTGTCTTGTCAGTCTCGGCCTGGAGGTAGGCCTACAGCAGGCGCCTGTC
CCCCCCCTATCTCACCTGCACCTCTCTTCCTGCGACGGTGCCAAGGTGGCCGATATCCTCTGCGCCTGGGATGAC
ATCTTGTCCAAGGAGCAAGGCCACGAGGTCATCAGGGGCGAGGCAGACACCTTTCTCATCTGGTCCCATCAAGAC
GGCCTCAACCTCGACGAGCTCTCTGACGCTCTCCCACACTCGCCGGAACCAGCCATCGGAGACGATGGTCAGGCC
GATTTCACCACGATCCCCAAGAGCATAATCGCCCACGAGCACGACCCGCCAAGCCCCGAGTCGACACCTCACTTC
GATCACGCACTCTTTTATGCCAATCTGGCGCGCTTTCAAGCCATTGAGCCCGACGCCACCGACTGGGGCAGCATC
CTGCTGTACGGCGAGGTGGTGACGAGCACCAACTCCCTTCTGGAAAAAAACTCCAAGTTGACCACCAGGCTGCCA
ACGGGCTTCACCTTTTCAGCCTCAACGCAGCTCGCAGGTCGTGGCCGCGGCACCAACTCCTGGATAGCGCCCCCT
GGAGCTCTCATGTTCTCGACCACCATCAACCACCCGGCACATCTTGCCGTCTCGCGTCCGGCCATATTCCTGCAG
TACATTGCCGCCATCGCCGTCGTCGAGGCCGTCCAGTCGCTGGGCGCGGGCTACGAGAAGCTACCGATAAAGCTC
AAGTGGCCCAACGACATCTACGCCCTCGACCCGACCAAGCCGGCCGCGCTGCGCCAGTACGTCAAGATCGGAGGC
GTCCTCTCCCATTGCGGCTACTGCGACGGCCAGTATCAAGTCGTGCTCGGCATCGGCGTCAACGCTACCAACCCG
CGTCCTACGACAGCCCTCTCGGATCTGCTGCCCGCGGGCGCCGCGCCTCTTCGGCTTGAGGTGCTCTTGGCCCGC
ATTCTCACTCGTCTCGAGGCCGTTCACGCGCAGTTCCTGCGACACGGCTTTTCCGAGGATTTGGAGCGACGGTAT
TATCGTCACTGGCTACACACGGGTCAGGCCATCTCTCTCGAGGCCGAGGGCGGGATACGTGCCCGTGTGCTCGGC
ATCACCAGGGATTGGGGCATGCTGCGTGCGGAGGAGACTGACGCAGAGGGAAGGGGCACGGGCAAGATTTGGAGC
CTTCAGAGCGATGAGAACAGCTTCGATTTCTGGAAGGGTCTGGTCCGACGGAAGACCTAG
Gene >Ophio5|6851
ATGGCGCAGCGGCGTCTCAACGTGCTCGTCTTCACTGGCGAGTCTCTCGGCCCCGTTCCCACGGCCCCCAATCGC
CGCCCATTGATCTGACCGGACAACTGGCAGGCACCGGCACCAGCGCCGAGTCGGTGCGGCAATGCCTTTACTCGC
TACGCCGACTGTTATCGCCCGATTACGCCGTCATCCCCGTCGGCGAAGCGGCGCTGCTCAAGGAGCCGTGGCCGT
CTACGTGCGCGCTGCTCGTCTTCCCCGGAGGCGCCGATCTCGGCTATTGTCGCGTCTTCAACGGCGCCGGCAACC
GTCGGATCCACGACTTTGTCCGGCGCGGCGGCGCGTACCTCGGCCTCTGTGCCGGAGGTTATTACGGCAGTGCGC
GATGCGAGTTTGAGGTCGGACATCCGCCGCTCGATGTCGTCGGCCCTCGTGAGCTGGCCTTCTTTCCCGCTGCCT
GTCGCGGCGCTGCCTTCTCCGGCTTTCGCTATGACAGCGAGATGGGAGCGCGAGCGGCTAGCCTCTGCGTCAATA
CGGCCTTCTTTGACGCTCCCGTGCCAAAGTCGTTTGCCTCTTATTATAACGGTGGTGGCGTCTTTGTTGATGCCG
CTCACCTCGATGCTGGCCATGTCCATGTCTTGGCCTCGTACGCCGACGAGCTCGACGTGGATGGCGGCCATGGCC
GCGCTGCTGTTGTCCTCTGTGACGTCGGAGATGGAAAAGCTGTTCTCTGCGGGCCGCATCCCGAGTGAGCGCGTC
CCAACTGCTCATGTCTACTCTGCTGATGCCCGCAGGTTTGCCGCCGTCAATCTTCATCCCCAGCCCGACATCCCC
TGGTATGCCGACCTCATCAGCAAGCTTGCCGCCCATGACCAGGCTCGCGTCAGCTTCTTGAGGGCCTGTCTTGTC
AGTCTCGGCCTGGAGGTAGGCCTACAGCAGGCGCCTGTCCCCCCCCTATCTCACCTGCACCTCTCTTCCTGCGAC
GGTGCCAAGGTGGCCGATATCCTCTGCGCCTGGGATGACATCTTGTCCAAGGAGCAAGGCCACGAGGTCATCAGG
GGCGAGGCAGACACCTTTCTCATCTGGTCCCATCAAGACGGCCTCAACCTCGACGAGCTCTCTGACGCTCTCCCA
CACTCGCCGGAACCAGCCATCGGAGACGATGGTCAGGCCGATTTCACCACGATCCCCAAGAGCATAATCGCCCAC
GAGCACGACCCGCCAAGCCCCGAGTCGACACCTCACTTCGATCACGCACTCTTTTATGCCAATCTGGCGCGCTTT
CAAGCCATTGAGCCCGACGCCACCGACTGGGGCAGCATCCTGCTGTACGGCGAGGTGGTGACGAGCACCAACTCC
CTTCTGGAAAAGTGCCTTCCTCCCGCCCTCTGCCGAGCCGAGACGCGCGGCTGATCCAATGTACCAGAAACTCCA
AGTTGACCACCAGGCTGCCAACGGGCTTCACCTTTTCAGCCTCAACGCAGCTCGCAGGTCGTGGCCGCGGCACCA
ACTCCTGGATAGCGCCCCCTGGAGCTCTCATGTTCTCGACCACCATCAACCACCCGGCACATCTTGCCGTCTCGC
GTCCGGCCATATTCCTGCAGTACATTGCCGCCATCGCCGTCGTCGAGGCCGTCCAGTCGCTGGGCGCGGGCTACG
AGAAGCTACCGATAAAGCTCAAGTGGCCCAACGACATCTACGCCCTCGACCCGACCAAGCCGGCCGCGCTGCGCC
AGTACGTCAAGATCGGAGGCGTCCTCTCCCATTGCGGCTACTGCGACGGCCAGTATCAAGTCGTGCTCGGCATCG
GCGTCAACGCTACCAACCCGCGTCCTACGACAGCCCTCTCGGATCTGCTGCCCGCGGGCGCCGCGCCTCTTCGGC
TTGAGGTGCTCTTGGCCCGCATTCTCACTCGTCTCGAGGCCGTTCACGCGCAGTTCCTGCGACACGGCTTTTCCG
AGGATTTGGAGCGACGGTATTATCGTCACTGGCTACACACGGGTCAGGCCATCTCTCTCGAGGCCGAGGGCGGGA
TACGTGCCCGTGTGCTCGGCATCACCAGGGATTGGGGCATGCTGCGTGCGGAGGAGACTGACGCAGAGGGAAGGG
GCACGGGCAAGATTTGGAGCCTTCAGAGCGATGAGAACAGCTTCGATTTCTGGAAGGGTCTGGTCCGACGGAAGA
CCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail