Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6850
Gene name
Locationscaffold_62:28218..28703
Strand+
Gene length (bp)485
Transcript length (bp)429
Coding sequence length (bp)426
Protein length (aa) 142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03656 Pam16 Pam16 9.6E-32 1 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I375|TIM16_GIBZE Mitochondrial import inner membrane translocase subunit TIM16 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAM16 PE=3 SV=1 1 141 6.0E-75
sp|Q7S6S4|TIM16_NEUCR Mitochondrial import inner membrane translocase subunit tim16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=un-4 PE=3 SV=1 1 142 1.0E-58
sp|Q5B187|TIM16_EMENI Mitochondrial import inner membrane translocase subunit tim16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pam16 PE=3 SV=1 1 142 4.0E-49
sp|Q754J4|TIM16_ASHGO Mitochondrial import inner membrane translocase subunit TIM16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAM16 PE=3 SV=2 1 117 4.0E-28
sp|P42949|TIM16_YEAST Mitochondrial import inner membrane translocase subunit TIM16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM16 PE=1 SV=1 1 133 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I375|TIM16_GIBZE Mitochondrial import inner membrane translocase subunit TIM16 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAM16 PE=3 SV=1 1 141 6.0E-75
sp|Q7S6S4|TIM16_NEUCR Mitochondrial import inner membrane translocase subunit tim16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=un-4 PE=3 SV=1 1 142 1.0E-58
sp|Q5B187|TIM16_EMENI Mitochondrial import inner membrane translocase subunit tim16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pam16 PE=3 SV=1 1 142 4.0E-49
sp|Q754J4|TIM16_ASHGO Mitochondrial import inner membrane translocase subunit TIM16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAM16 PE=3 SV=2 1 117 4.0E-28
sp|P42949|TIM16_YEAST Mitochondrial import inner membrane translocase subunit TIM16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM16 PE=1 SV=1 1 133 1.0E-23
sp|Q9VF08|TIM16_DROME Mitochondrial import inner membrane translocase subunit Tim16 OS=Drosophila melanogaster GN=blp PE=2 SV=1 4 117 2.0E-21
sp|Q6CK35|TIM16_KLULA Mitochondrial import inner membrane translocase subunit TIM16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAM16 PE=3 SV=1 1 117 3.0E-20
sp|Q6FT88|TIM16_CANGA Mitochondrial import inner membrane translocase subunit TIM16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAM16 PE=3 SV=1 1 117 6.0E-20
sp|Q6NTU3|TI16A_XENLA Mitochondrial import inner membrane translocase subunit tim16-A OS=Xenopus laevis GN=pam16-a PE=2 SV=1 4 117 1.0E-18
sp|Q9C1W5|TIM16_SCHPO Mitochondrial import inner membrane translocase subunit tim16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pam16 PE=3 SV=1 4 117 2.0E-18
sp|Q6C331|TIM16_YARLI Mitochondrial import inner membrane translocase subunit TIM16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM16 PE=3 SV=1 1 120 2.0E-18
sp|Q5XGJ0|TIM16_XENTR Mitochondrial import inner membrane translocase subunit tim16 OS=Xenopus tropicalis GN=pam16 PE=2 SV=1 4 125 4.0E-18
sp|Q6BXP3|TIM16_DEBHA Mitochondrial import inner membrane translocase subunit TIM16 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAM16 PE=3 SV=2 1 117 5.0E-18
sp|Q5M995|TI16B_XENLA Mitochondrial import inner membrane translocase subunit tim16-B OS=Xenopus laevis GN=pam16-b PE=2 SV=1 4 117 2.0E-17
sp|O62250|TIM16_CAEEL Mitochondrial import inner membrane translocase subunit tim-16 OS=Caenorhabditis elegans GN=tim-16 PE=3 SV=1 14 120 2.0E-17
sp|Q9CQV1|TIM16_MOUSE Mitochondrial import inner membrane translocase subunit TIM16 OS=Mus musculus GN=Pam16 PE=1 SV=1 4 137 1.0E-16
sp|Q9Y3D7|TIM16_HUMAN Mitochondrial import inner membrane translocase subunit TIM16 OS=Homo sapiens GN=PAM16 PE=1 SV=2 4 117 4.0E-16
sp|Q6EIX2|TIM16_RAT Mitochondrial import inner membrane translocase subunit TIM16 OS=Rattus norvegicus GN=Magmas-ps1 PE=3 SV=1 4 137 2.0E-15
sp|Q6PBL0|TIM16_DANRE Mitochondrial import inner membrane translocase subunit tim16 OS=Danio rerio GN=pam16 PE=2 SV=1 4 117 3.0E-15
sp|Q60RS2|TIM16_CAEBR Mitochondrial import inner membrane translocase subunit tim-16 OS=Caenorhabditis briggsae GN=tim-16 PE=3 SV=1 56 125 4.0E-15
sp|Q59ZW9|TIM16_CANAL Mitochondrial import inner membrane translocase subunit TIM16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM16 PE=3 SV=1 1 117 5.0E-15
sp|Q54SV6|TIM16_DICDI Mitochondrial import inner membrane translocase subunit tim16 OS=Dictyostelium discoideum GN=timm16 PE=3 SV=1 1 117 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6850
MAHRFIITAFVTGSRILGRSFMAAYKQAQAASQYQRAQAKMGGSSASSAPSSLSSGMSLDEACRILNVKPPASGL
ANAEEVVQRYKQLFDANDPEKGGSFYLQSKIVRAKERFERDLGPIRAKAELEAEIKEGWKPKIYKNR
Coding >Ophio5|6850
ATGGCACACCGATTCATCATCACCGCCTTCGTCACCGGCTCCCGTATCCTAGGCCGGTCCTTCATGGCCGCCTAC
AAGCAAGCGCAAGCGGCTTCGCAATACCAGCGCGCACAAGCGAAAATGGGCGGCAGCTCCGCCTCCTCGGCGCCG
TCCTCCCTGTCGTCCGGCATGTCGCTCGACGAGGCTTGTCGTATCCTCAACGTCAAGCCGCCGGCCAGCGGACTC
GCCAACGCGGAAGAGGTCGTCCAGCGGTACAAGCAACTCTTTGACGCAAACGATCCTGAAAAGGGGGGCAGCTTC
TACCTTCAGAGCAAGATTGTAAGAGCCAAGGAACGCTTTGAGCGTGATCTCGGCCCTATACGAGCAAAGGCCGAG
TTGGAGGCTGAAATCAAGGAGGGCTGGAAGCCAAAAATCTACAAGAATCGG
Transcript >Ophio5|6850
ATGGCACACCGATTCATCATCACCGCCTTCGTCACCGGCTCCCGTATCCTAGGCCGGTCCTTCATGGCCGCCTAC
AAGCAAGCGCAAGCGGCTTCGCAATACCAGCGCGCACAAGCGAAAATGGGCGGCAGCTCCGCCTCCTCGGCGCCG
TCCTCCCTGTCGTCCGGCATGTCGCTCGACGAGGCTTGTCGTATCCTCAACGTCAAGCCGCCGGCCAGCGGACTC
GCCAACGCGGAAGAGGTCGTCCAGCGGTACAAGCAACTCTTTGACGCAAACGATCCTGAAAAGGGGGGCAGCTTC
TACCTTCAGAGCAAGATTGTAAGAGCCAAGGAACGCTTTGAGCGTGATCTCGGCCCTATACGAGCAAAGGCCGAG
TTGGAGGCTGAAATCAAGGAGGGCTGGAAGCCAAAAATCTACAAGAATCGGTAG
Gene >Ophio5|6850
ATGGTATCACGAGAATTGTCGCTCAGTCGAAAACCAACTTGTCCGCTAACTCGTCTCAGGCACACCGATTCATCA
TCACCGCCTTCGTCACCGGCTCCCGTATCCTAGGCCGGTCCTTCATGGCCGCCTACAAGCAAGCGCAAGCGGCTT
CGCAATACCAGCGCGCACAAGCGAAAATGGGCGGCAGCTCCGCCTCCTCGGCGCCGTCCTCCCTGTCGTCCGGCA
TGTCGCTCGACGAGGCTTGTCGTATCCTCAACGTCAAGCCGCCGGCCAGCGGACTCGCCAACGCGGAAGAGGTCG
TCCAGCGGTACAAGCAACTCTTTGACGCAAACGATCCTGAAAAGGGGGGCAGCTTCTACCTTCAGAGCAAGATTG
TAAGAGCCAAGGAACGCTTTGAGCGTGATCTCGGCCCTATACGAGCAAAGGCCGAGTTGGAGGCTGAAATCAAGG
AGGGCTGGAAGCCAAAAATCTACAAGAATCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail