Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6822
Gene name
Locationscaffold_615:8368..9895
Strand-
Gene length (bp)1527
Transcript length (bp)1452
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.7E-53 67 461

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 51 483 0.0E+00
sp|Q38967|AAP2_ARATH Amino acid permease 2 OS=Arabidopsis thaliana GN=AAP2 PE=1 SV=1 57 464 2.0E-09
sp|Q9FN04|AAP4_ARATH Amino acid permease 4 OS=Arabidopsis thaliana GN=AAP4 PE=1 SV=1 57 464 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 68 87 19
2 92 114 22
3 143 165 22
4 175 197 22
5 204 226 22
6 253 275 22
7 288 310 22
8 330 352 22
9 373 395 22
10 400 422 22
11 443 465 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6822
MGIMEYSTEPDAKLVKTLSQPREQSSSSSSDNVLVGSAIAGEVSEFEERRGDVEKQKMADGDAHFHRLGWKRLTV
ILIVEAVALGSLSLPAAFATLGMVAGVICCVGLGLIAIYTSDIVGKVKLKHPEVAHYADAGRLLMGRFGYELVGA
MFVLQLTFLVGSHTLTGTIAFLNITNNGACSVIFAFISAIILLLLAVPPSFAEVAILGYIDFVSIFAAIGITIIA
TGVQAGDAPGGLAAVPWSAWPKPGINFADAFIAIANIVFAYSFCMCQFSFMDEMHTPSDYLKSVWSLGIIEMAIY
TLTGALIYSFVGVDVKSPALLSAGPLISKIAFGVALPVIFISGSINTTVVGRYIHGRIFRDSVTRFINTPRGWIT
WLAVITVITIAAFVIAEVIPFFSDLLSISSSLFVSGFTFYLPAMMWFKLLRVGPWYSRENIVNALMNGFCFVIGI
VVLVCGTYGSIVDIVRHFRAGTVRGVFTCEPIA
Coding >Ophio5|6822
ATGGGCATCATGGAGTATTCGACAGAGCCCGACGCGAAGCTCGTCAAGACATTGTCACAGCCGCGGGAACAGTCT
TCATCTTCGTCATCGGATAATGTGCTAGTCGGCAGCGCCATCGCGGGCGAGGTCAGCGAATTCGAGGAAAGGCGC
GGCGACGTGGAGAAGCAAAAGATGGCGGACGGAGACGCTCACTTTCACCGACTAGGCTGGAAACGATTGACTGTG
ATCCTCATCGTCGAGGCAGTCGCCCTGGGCAGCTTGAGTTTGCCGGCAGCCTTCGCGACGCTGGGCATGGTGGCT
GGAGTCATCTGCTGTGTCGGGCTCGGCCTCATCGCCATCTACACGAGCGACATCGTGGGAAAAGTCAAGCTCAAG
CACCCGGAGGTGGCTCATTACGCCGACGCCGGACGCCTGCTCATGGGCCGGTTCGGATACGAGCTCGTGGGCGCC
ATGTTCGTCTTGCAGTTGACCTTTCTCGTCGGCTCGCATACGCTGACGGGTACCATTGCCTTTCTCAACATCACC
AACAATGGCGCCTGCTCCGTCATCTTCGCCTTCATCTCGGCCATCATCCTGCTGCTCCTGGCCGTTCCGCCTTCG
TTCGCCGAGGTGGCTATTCTCGGATACATTGACTTCGTCTCCATCTTCGCCGCTATAGGCATCACCATCATCGCC
ACCGGCGTCCAGGCCGGCGATGCCCCGGGCGGCCTGGCCGCCGTCCCGTGGTCGGCCTGGCCCAAGCCCGGCATC
AACTTCGCCGACGCCTTCATCGCCATCGCCAACATCGTCTTCGCCTACAGCTTCTGCATGTGTCAGTTCTCCTTC
ATGGACGAGATGCACACGCCCAGCGACTACCTCAAGTCGGTCTGGTCCCTCGGCATCATCGAGATGGCCATTTAC
ACCCTCACCGGCGCCCTCATCTACTCCTTTGTCGGCGTCGATGTCAAGTCGCCCGCACTGCTGTCCGCCGGCCCC
CTCATCTCCAAGATTGCCTTTGGCGTCGCTCTGCCCGTCATCTTCATCTCGGGCTCCATCAACACCACCGTCGTG
GGGCGCTACATCCACGGCCGCATCTTCCGCGACTCCGTCACCCGCTTCATCAACACGCCCAGGGGCTGGATCACC
TGGCTCGCTGTCATCACCGTCATCACCATCGCCGCCTTTGTCATCGCCGAGGTCATCCCCTTCTTCTCCGATCTG
CTGTCCATCTCGTCGTCTCTTTTCGTCTCCGGCTTCACCTTTTATCTGCCGGCTATGATGTGGTTCAAGCTGCTC
CGGGTTGGGCCTTGGTATTCGCGCGAGAACATTGTCAACGCCCTCATGAACGGCTTTTGCTTTGTCATTGGCATC
GTCGTCTTGGTCTGCGGAACATACGGCAGCATCGTCGATATTGTTCGTCATTTCAGGGCGGGCACGGTTCGCGGT
GTCTTTACGTGCGAACCCATCGCG
Transcript >Ophio5|6822
ATGGGCATCATGGAGTATTCGACAGAGCCCGACGCGAAGCTCGTCAAGACATTGTCACAGCCGCGGGAACAGTCT
TCATCTTCGTCATCGGATAATGTGCTAGTCGGCAGCGCCATCGCGGGCGAGGTCAGCGAATTCGAGGAAAGGCGC
GGCGACGTGGAGAAGCAAAAGATGGCGGACGGAGACGCTCACTTTCACCGACTAGGCTGGAAACGATTGACTGTG
ATCCTCATCGTCGAGGCAGTCGCCCTGGGCAGCTTGAGTTTGCCGGCAGCCTTCGCGACGCTGGGCATGGTGGCT
GGAGTCATCTGCTGTGTCGGGCTCGGCCTCATCGCCATCTACACGAGCGACATCGTGGGAAAAGTCAAGCTCAAG
CACCCGGAGGTGGCTCATTACGCCGACGCCGGACGCCTGCTCATGGGCCGGTTCGGATACGAGCTCGTGGGCGCC
ATGTTCGTCTTGCAGTTGACCTTTCTCGTCGGCTCGCATACGCTGACGGGTACCATTGCCTTTCTCAACATCACC
AACAATGGCGCCTGCTCCGTCATCTTCGCCTTCATCTCGGCCATCATCCTGCTGCTCCTGGCCGTTCCGCCTTCG
TTCGCCGAGGTGGCTATTCTCGGATACATTGACTTCGTCTCCATCTTCGCCGCTATAGGCATCACCATCATCGCC
ACCGGCGTCCAGGCCGGCGATGCCCCGGGCGGCCTGGCCGCCGTCCCGTGGTCGGCCTGGCCCAAGCCCGGCATC
AACTTCGCCGACGCCTTCATCGCCATCGCCAACATCGTCTTCGCCTACAGCTTCTGCATGTGTCAGTTCTCCTTC
ATGGACGAGATGCACACGCCCAGCGACTACCTCAAGTCGGTCTGGTCCCTCGGCATCATCGAGATGGCCATTTAC
ACCCTCACCGGCGCCCTCATCTACTCCTTTGTCGGCGTCGATGTCAAGTCGCCCGCACTGCTGTCCGCCGGCCCC
CTCATCTCCAAGATTGCCTTTGGCGTCGCTCTGCCCGTCATCTTCATCTCGGGCTCCATCAACACCACCGTCGTG
GGGCGCTACATCCACGGCCGCATCTTCCGCGACTCCGTCACCCGCTTCATCAACACGCCCAGGGGCTGGATCACC
TGGCTCGCTGTCATCACCGTCATCACCATCGCCGCCTTTGTCATCGCCGAGGTCATCCCCTTCTTCTCCGATCTG
CTGTCCATCTCGTCGTCTCTTTTCGTCTCCGGCTTCACCTTTTATCTGCCGGCTATGATGTGGTTCAAGCTGCTC
CGGGTTGGGCCTTGGTATTCGCGCGAGAACATTGTCAACGCCCTCATGAACGGCTTTTGCTTTGTCATTGGCATC
GTCGTCTTGGTCTGCGGAACATACGGCAGCATCGTCGATATTGTTCGTCATTTCAGGGCGGGCACGGTTCGCGGT
GTCTTTACGTGCGAACCCATCGCGTAA
Gene >Ophio5|6822
ATGGGCATCATGGAGTATTCGACAGAGCCCGACGCGAAGCTCGTCAAGACATTGTCACAGCCGCGGGAACAGTCT
TCATCTTCGTCATCGGATAATGTGCTAGTCGGCAGCGCCATCGCGGGCGAGGTCAGCGAATTCGAGGAAAGGCGC
GGCGACGTGGAGAAGCAAAAGATGGCGGACGGAGACGCTCACTTTCACCGACTAGGCTGGAAACGATTGACTGTG
ATCCTCATCGTCGAGGCAGTCGCCCTGGGCAGCTTGAGTTTGCCGGCAGCCTTCGCGACGCTGGGCATGGTGGCT
GGAGTCATCTGCTGTGTCGGGCTCGGCCTCATCGCCATCTACACGAGCGACATCGTGGGAAAAGTCAAGCTCAAG
CACCCGGAGGTGGCTCATTACGCCGACGCCGGACGCCTGCTCATGGGCCGGTTCGGATACGAGCTCGTGGGCGCC
ATGTTCGTCTTGCAGTTGACCTTTCTCGTCGGCTCGCATACGCTGACGGGTACCATTGCCTTTCTCAACATCACC
AACAATGGCGCCTGCTCCGTCATCTTCGCCTTCATCTCGGCCATCATCCTGCTGCTCCTGGCCGTTCCGCCTTCG
TTCGCCGAGGTGGCTATTCTCGGATACATTGACTTCGTCTCCATCTTCGCCGCTATAGGCATCACCATCATCGCC
ACCGGCGTCCAGGCCGGCGATGCCCCGGGCGGCCTGGCCGCCGTCCCGTGGTCGGCCTGGCCCAAGCCCGGCATC
AACTTCGCCGACGCCTTCATCGCCATCGCCAACATCGTCTTCGCCTACAGCTTCTGCATGTGTCAGTTCTCCTTC
ATGGACGAGATGCACACGCCCAGCGACTACCTCAAGTCGGTCTGGTCCCTCGGCATCATCGAGATGGCCATTTAC
ACCCTCACCGGCGCCCTCATCTACTCCTTTGTCGGCGTCGATGTCAAGTCGCCCGCACTGCTGTCCGCCGGCCCC
CTCATCTCCAAGATTGCCTTTGGCGTCGCTCTGCCCGTCATCTTCATCTCGGGCTCCATCAACACCACCGTCGTG
GGGCGCTACATCCACGGCCGCATCTTCCGCGACTCCGTCACCCGCTTCATCAACACGCCCAGGGGCTGGATCACC
TGGCTCGCTGTCATCACCGTCATCACCATCGCCGCCTTTGTCATCGCCGAGGTCATCCCCTTCTTCTCCGATCTG
CTGTCCATCTCGTCGTCTCTTTTCGTCTCCGGCTTCACCTTTTATCTGCCGGCTATGATGTGGTTCAAGCTGCTC
CGGGTTGGGCCTTGGTATTCGCGCGAGAACATTGTCAACGCCCTCATGAACGGCTTTTGCTTTGTCATTGGCATC
GTCGTCTTGGTCTGCGGAACATACGGCAGCATCGTCGATATTGTGAGTCCAGTCCGTTCTGTTTTTTTTTTTGCT
TCCTTCAAAGACTGCTGCTAACAAGCCTACGCTCGCTTCCAGGTTCGTCATTTCAGGGCGGGCACGGTTCGCGGT
GTCTTTACGTGCGAACCCATCGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail