Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6818
Gene name
Locationscaffold_615:2889..3326
Strand+
Gene length (bp)437
Transcript length (bp)372
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35 5.8E-29 31 116
PF02449 Glyco_hydro_42 Beta-galactosidase 1.0E-07 46 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48982|BGAL_XANMN Beta-galactosidase OS=Xanthomonas manihotis GN=bga PE=1 SV=1 19 115 1.0E-26
sp|Q3UPY5|GLBL2_MOUSE Beta-galactosidase-1-like protein 2 OS=Mus musculus GN=Glb1l2 PE=1 SV=1 31 120 2.0E-19
sp|Q9TRY9|BGAL_CANLF Beta-galactosidase OS=Canis lupus familiaris GN=GLB1 PE=2 SV=3 19 116 5.0E-19
sp|Q60HF6|BGAL_MACFA Beta-galactosidase OS=Macaca fascicularis GN=GLB1 PE=2 SV=1 23 116 5.0E-19
sp|P23780|BGAL_MOUSE Beta-galactosidase OS=Mus musculus GN=Glb1 PE=1 SV=1 26 116 7.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48982|BGAL_XANMN Beta-galactosidase OS=Xanthomonas manihotis GN=bga PE=1 SV=1 19 115 1.0E-26
sp|Q3UPY5|GLBL2_MOUSE Beta-galactosidase-1-like protein 2 OS=Mus musculus GN=Glb1l2 PE=1 SV=1 31 120 2.0E-19
sp|Q9TRY9|BGAL_CANLF Beta-galactosidase OS=Canis lupus familiaris GN=GLB1 PE=2 SV=3 19 116 5.0E-19
sp|Q60HF6|BGAL_MACFA Beta-galactosidase OS=Macaca fascicularis GN=GLB1 PE=2 SV=1 23 116 5.0E-19
sp|P23780|BGAL_MOUSE Beta-galactosidase OS=Mus musculus GN=Glb1 PE=1 SV=1 26 116 7.0E-19
sp|Q58D55|BGAL_BOVIN Beta-galactosidase OS=Bos taurus GN=GLB1 PE=2 SV=1 26 116 2.0E-18
sp|O19015|BGAL_FELCA Beta-galactosidase OS=Felis catus GN=GLB1 PE=2 SV=1 26 116 2.0E-18
sp|P16278|BGAL_HUMAN Beta-galactosidase OS=Homo sapiens GN=GLB1 PE=1 SV=2 26 116 4.0E-18
sp|Q8IW92|GLBL2_HUMAN Beta-galactosidase-1-like protein 2 OS=Homo sapiens GN=GLB1L2 PE=2 SV=1 30 120 4.0E-18
sp|Q5R7P4|BGAL_PONAB Beta-galactosidase OS=Pongo abelii GN=GLB1 PE=2 SV=1 26 116 2.0E-17
sp|Q8NCI6|GLBL3_HUMAN Beta-galactosidase-1-like protein 3 OS=Homo sapiens GN=GLB1L3 PE=2 SV=3 16 120 7.0E-17
sp|Q0DGD7|BGAL8_ORYSJ Beta-galactosidase 8 OS=Oryza sativa subsp. japonica GN=Os05g0539400 PE=2 SV=1 37 116 2.0E-16
sp|Q5XIL5|GLBL3_RAT Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus GN=Glb1l3 PE=2 SV=1 16 116 4.0E-15
sp|Q93Z24|BGA17_ARATH Beta-galactosidase 17 OS=Arabidopsis thaliana GN=BGAL17 PE=2 SV=1 24 116 5.0E-14
sp|A2RSQ1|GLBL3_MOUSE Beta-galactosidase-1-like protein 3 OS=Mus musculus GN=Glb1l3 PE=1 SV=1 17 116 5.0E-14
sp|Q67VU7|BGA10_ORYSJ Putative beta-galactosidase 10 OS=Oryza sativa subsp. japonica GN=Os06g0628500 PE=3 SV=1 25 116 7.0E-14
sp|Q9FN08|BGA10_ARATH Beta-galactosidase 10 OS=Arabidopsis thaliana GN=BGAL10 PE=2 SV=1 23 117 2.0E-13
sp|Q95LV1|GLB1L_MACFA Beta-galactosidase-1-like protein OS=Macaca fascicularis GN=GLB1L PE=2 SV=1 27 116 3.0E-13
sp|Q7G3T8|BGA13_ORYSJ Beta-galactosidase 13 OS=Oryza sativa subsp. japonica GN=Os10g0330600 PE=2 SV=1 26 116 3.0E-13
sp|Q6UWU2|GLB1L_HUMAN Beta-galactosidase-1-like protein OS=Homo sapiens GN=GLB1L PE=2 SV=1 23 116 4.0E-13
sp|Q8VC60|GLB1L_MOUSE Beta-galactosidase-1-like protein OS=Mus musculus GN=Glb1l PE=1 SV=1 23 116 1.0E-12
sp|Q9SCW1|BGAL1_ARATH Beta-galactosidase 1 OS=Arabidopsis thaliana GN=BGAL1 PE=1 SV=1 23 116 1.0E-12
sp|Q9SCV9|BGAL3_ARATH Beta-galactosidase 3 OS=Arabidopsis thaliana GN=BGAL3 PE=1 SV=1 25 116 1.0E-12
sp|Q9MAJ7|BGAL5_ARATH Beta-galactosidase 5 OS=Arabidopsis thaliana GN=BGAL5 PE=2 SV=1 1 116 2.0E-12
sp|Q7XFK2|BGA14_ORYSJ Beta-galactosidase 14 OS=Oryza sativa subsp. japonica GN=Os10g0340600 PE=2 SV=1 25 116 2.0E-12
sp|Q8GX69|BGA16_ARATH Beta-galactosidase 16 OS=Arabidopsis thaliana GN=BGAL16 PE=2 SV=2 23 116 3.0E-12
sp|Q9SCU8|BGA14_ARATH Beta-galactosidase 14 OS=Arabidopsis thaliana GN=BGAL14 PE=2 SV=2 6 116 4.0E-12
sp|Q0IZZ8|BGA12_ORYSJ Beta-galactosidase 12 OS=Oryza sativa subsp. japonica GN=Os09g0539200 PE=2 SV=2 25 116 5.0E-12
sp|P49676|BGAL_BRAOL Beta-galactosidase OS=Brassica oleracea PE=2 SV=1 3 116 6.0E-12
sp|Q9SCV1|BGA11_ARATH Beta-galactosidase 11 OS=Arabidopsis thaliana GN=BGAL11 PE=2 SV=1 47 116 1.0E-11
sp|Q8W0A1|BGAL2_ORYSJ Beta-galactosidase 2 OS=Oryza sativa subsp. japonica GN=Os01g0580200 PE=2 SV=1 25 116 1.0E-11
sp|Q5BFC4|BGALA_EMENI Probable beta-galactosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lacA PE=3 SV=2 25 116 1.0E-11
sp|Q9SCU9|BGA13_ARATH Beta-galactosidase 13 OS=Arabidopsis thaliana GN=BGAL13 PE=2 SV=1 47 116 1.0E-11
sp|Q9SCV5|BGAL7_ARATH Beta-galactosidase 7 OS=Arabidopsis thaliana GN=BGAL7 PE=2 SV=2 25 116 1.0E-11
sp|A1D1Z9|BGALA_NEOFI Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lacA PE=3 SV=1 25 116 2.0E-11
sp|P45582|BGAL_ASPOF Beta-galactosidase OS=Asparagus officinalis PE=2 SV=1 25 116 2.0E-11
sp|Q8RUV9|BGAL1_ORYSJ Beta-galactosidase 1 OS=Oryza sativa subsp. japonica GN=Os01g0533400 PE=2 SV=1 25 116 2.0E-11
sp|Q4WS33|BGALA_ASPFU Probable beta-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacA PE=3 SV=2 25 116 3.0E-11
sp|B0XMP7|BGALA_ASPFC Probable beta-galactosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacA PE=3 SV=2 25 116 3.0E-11
sp|Q9SCV4|BGAL8_ARATH Beta-galactosidase 8 OS=Arabidopsis thaliana GN=BGAL8 PE=2 SV=2 23 116 4.0E-11
sp|Q6ZJJ0|BGA11_ORYSJ Beta-galactosidase 11 OS=Oryza sativa subsp. japonica GN=Os08g0549200 PE=2 SV=1 25 116 5.0E-11
sp|P48981|BGAL_MALDO Beta-galactosidase OS=Malus domestica PE=1 SV=1 3 116 7.0E-11
sp|Q9FFN4|BGAL6_ARATH Beta-galactosidase 6 OS=Arabidopsis thaliana GN=BGAL6 PE=2 SV=1 19 116 9.0E-11
sp|Q10RB4|BGAL5_ORYSJ Beta-galactosidase 5 OS=Oryza sativa subsp. japonica GN=Os03g0165400 PE=2 SV=1 25 116 1.0E-10
sp|Q9SCV0|BGA12_ARATH Beta-galactosidase 12 OS=Arabidopsis thaliana GN=BGAL12 PE=2 SV=1 25 116 2.0E-10
sp|Q9LFA6|BGAL2_ARATH Beta-galactosidase 2 OS=Arabidopsis thaliana GN=BGAL2 PE=2 SV=2 25 116 4.0E-10
sp|Q5Z7L0|BGAL9_ORYSJ Beta-galactosidase 9 OS=Oryza sativa subsp. japonica GN=Os06g0573600 PE=2 SV=1 25 116 5.0E-10
sp|Q54GE1|BGAL1_DICDI Beta-galactosidase 1 OS=Dictyostelium discoideum GN=glb1 PE=3 SV=1 38 115 5.0E-10
sp|Q75HQ3|BGAL7_ORYSJ Beta-galactosidase 7 OS=Oryza sativa subsp. japonica GN=Os05g0428100 PE=3 SV=1 24 116 7.0E-10
sp|Q9SCV3|BGAL9_ARATH Beta-galactosidase 9 OS=Arabidopsis thaliana GN=BGAL9 PE=2 SV=1 2 116 9.0E-10
sp|Q9SCV8|BGAL4_ARATH Beta-galactosidase 4 OS=Arabidopsis thaliana GN=BGAL4 PE=1 SV=1 25 116 1.0E-09
sp|Q9C6W4|BGA15_ARATH Beta-galactosidase 15 OS=Arabidopsis thaliana GN=BGAL15 PE=2 SV=1 40 116 2.0E-09
sp|Q6Z6K4|BGAL4_ORYSJ Beta-galactosidase 4 OS=Oryza sativa subsp. japonica GN=Os02g0219200 PE=2 SV=1 25 116 2.0E-09
sp|A2X2H7|BGAL4_ORYSI Beta-galactosidase 4 OS=Oryza sativa subsp. indica GN=OsI_006270 PE=3 SV=1 25 116 2.0E-09
sp|Q10NX8|BGAL6_ORYSJ Beta-galactosidase 6 OS=Oryza sativa subsp. japonica GN=Os03g0255100 PE=1 SV=2 23 116 3.0E-09
sp|Q5N8X6|BGAL3_ORYSJ Beta-galactosidase 3 OS=Oryza sativa subsp. japonica GN=Os01g0875500 PE=3 SV=1 25 117 4.0E-09
sp|Q0INM3|BGA15_ORYSJ Beta-galactosidase 15 OS=Oryza sativa subsp. japonica GN=Os12g0429200 PE=2 SV=1 23 115 5.0E-09
sp|P48980|BGAL_SOLLC Beta-galactosidase OS=Solanum lycopersicum PE=1 SV=1 25 115 1.0E-08
sp|P29853|BGAL_ASPNG Beta-galactosidase OS=Aspergillus niger GN=lacA PE=1 SV=2 25 116 2.0E-08
sp|Q700S9|BGALA_PENSQ Probable beta-galactosidase A OS=Penicillium sp. GN=lacA PE=1 SV=1 25 121 2.0E-08
sp|Q4ZHV7|BGALA_ASPPH Probable beta-galactosidase A OS=Aspergillus phoenicis GN=lacA PE=2 SV=1 25 116 2.0E-08
sp|A2QAN3|BGALA_ASPNC Probable beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lacA PE=3 SV=1 25 116 2.0E-08
sp|B8NKI4|BGALB_ASPFN Probable beta-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lacB PE=3 SV=2 21 116 5.0E-08
sp|Q2U6P1|BGALB_ASPOR Probable beta-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lacB PE=3 SV=2 21 116 5.0E-08
sp|Q2UCU3|BGALA_ASPOR Probable beta-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lacA PE=1 SV=1 25 121 7.0E-08
sp|B8N6V7|BGALA_ASPFN Probable beta-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lacA PE=3 SV=1 25 121 7.0E-08
sp|B8QGZ3|BGALA_PENEN Probable beta-galactosidase A OS=Penicillium expansum GN=lacA PE=2 SV=1 25 121 1.0E-07
sp|A1DM65|BGALC_NEOFI Probable beta-galactosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lacC PE=3 SV=1 20 115 2.0E-07
sp|Q4WNE4|BGALC_ASPFU Probable beta-galactosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacC PE=3 SV=1 20 115 2.0E-07
sp|B0Y752|BGALC_ASPFC Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacC PE=3 SV=1 20 115 2.0E-07
sp|Q00662|BGAL_DIACA Putative beta-galactosidase OS=Dianthus caryophyllus GN=CARSR12 PE=2 SV=1 9 115 2.0E-07
sp|Q4WG05|BGALE_ASPFU Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacE PE=3 SV=1 25 122 4.0E-07
sp|B0XXE7|BGALE_ASPFC Probable beta-galactosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacE PE=3 SV=1 25 122 4.0E-07
sp|A6RPN7|BGALB_BOTFB Probable beta-galactosidase B OS=Botryotinia fuckeliana (strain B05.10) GN=lacB PE=3 SV=1 21 116 7.0E-07
sp|A2QL84|BGALC_ASPNC Probable beta-galactosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lacC PE=3 SV=1 40 115 8.0E-07
sp|A1CE56|BGALC_ASPCL Probable beta-galactosidase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lacC PE=3 SV=1 23 115 1.0E-06
sp|B8N2I5|BGALC_ASPFN Probable beta-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=lacC PE=3 SV=1 36 115 1.0E-06
sp|Q2UMD5|BGALC_ASPOR Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lacC PE=3 SV=1 36 115 1.0E-06
sp|Q54MV6|BGAL2_DICDI Probable beta-galactosidase 2 OS=Dictyostelium discoideum GN=glb2 PE=3 SV=1 25 116 1.0E-06
sp|A2QA64|BGALB_ASPNC Probable beta-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lacB PE=3 SV=2 21 116 1.0E-06
sp|A1DJ58|BGALE_NEOFI Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lacE PE=3 SV=1 25 122 2.0E-06
sp|B6GW04|BGALB_PENRW Probable beta-galactosidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lacB PE=3 SV=2 21 116 2.0E-06
sp|B6QHA9|BGALC_TALMQ Probable beta-galactosidase C OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=lacC PE=3 SV=1 2 121 3.0E-06
sp|A7EBU5|BGALB_SCLS1 Probable beta-galactosidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=lacB PE=3 SV=1 21 116 3.0E-06
sp|Q4WRD3|BGALB_ASPFU Probable beta-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lacB PE=3 SV=1 40 122 5.0E-06
sp|B0XNY2|BGALB_ASPFC Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=lacB PE=3 SV=1 40 122 5.0E-06
sp|B6H5X9|BGALC_PENRW Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lacC PE=3 SV=1 2 115 5.0E-06
sp|Q0CMF3|BGALB_ASPTN Probable beta-galactosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lacB PE=3 SV=2 21 116 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009341 beta-galactosidase complex Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0004565 beta-galactosidase activity Yes
GO:0016787 hydrolase activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0015925 galactosidase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6818
MLLSTLLRVLATAYLCLGSSWENFTYNERHFLLGREPFQIIGGQMDPQRIPQPYWRQRLQMARAMGLNTIFSSVF
WNKIEPAPGKWDFSGNNDIVHFFRLAQDQGLKLVLRPGPYIGERLAVP
Coding >Ophio5|6818
ATGCTTCTCAGTACCTTACTACGAGTCCTGGCGACAGCCTACCTCTGTCTCGGCTCGTCATGGGAAAACTTCACC
TACAATGAGAGACACTTCCTTCTCGGTAGAGAGCCCTTTCAGATCATCGGCGGCCAGATGGATCCGCAACGCATC
CCCCAGCCATACTGGCGCCAGAGGCTTCAAATGGCACGGGCCATGGGGCTCAACACCATCTTCAGCTCCGTCTTC
TGGAACAAGATTGAGCCCGCGCCAGGGAAATGGGACTTTAGCGGCAACAACGACATTGTTCATTTCTTCCGCTTG
GCTCAGGACCAGGGACTCAAGCTGGTGCTTCGCCCCGGGCCGTACATCGGCGAACGGCTCGCCGTTCCT
Transcript >Ophio5|6818
ATGCTTCTCAGTACCTTACTACGAGTCCTGGCGACAGCCTACCTCTGTCTCGGCTCGTCATGGGAAAACTTCACC
TACAATGAGAGACACTTCCTTCTCGGTAGAGAGCCCTTTCAGATCATCGGCGGCCAGATGGATCCGCAACGCATC
CCCCAGCCATACTGGCGCCAGAGGCTTCAAATGGCACGGGCCATGGGGCTCAACACCATCTTCAGCTCCGTCTTC
TGGAACAAGATTGAGCCCGCGCCAGGGAAATGGGACTTTAGCGGCAACAACGACATTGTTCATTTCTTCCGCTTG
GCTCAGGACCAGGGACTCAAGCTGGTGCTTCGCCCCGGGCCGTACATCGGCGAACGGCTCGCCGTTCCTTGA
Gene >Ophio5|6818
ATGCTTCTCAGTACCTTACTACGAGTCCTGGCGACAGCCTACCTCTGTCTCGGCTCGTCATGGGAAAACTTCACC
TACAATGAGAGACACTTCCTTCTCGGTAGAGAGCCCTTTCAGATCATCGGCGGCCAGATGGATCCGCAACGCATC
CCCCAGCCATACTGGCGCCAGAGGCTTCAAATGGCACGGGCCATGGGGCTCAACACCATCTTCAGCTCCGTCTTC
TGGAACAAGATTGAGCCCGCGCCAGGGAAATGGGACTTTAGCGGCAACAACGACATTGTTCATTTCTTCCGCTTG
GCTCAGGACCAGGGACTCAAGCTGGTGCTTCGCCCCGGGCCGTACATCGGCGGTGAGCGTGACTGGGGAGGCCTC
CCAGCCTGGCTGAGTCAAATTTCTGATATGAAGATCCGCCAGAACGGCTCGCCGTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail