Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6813
Gene name
Locationscaffold_614:4635..5699
Strand+
Gene length (bp)1064
Transcript length (bp)1005
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01027 Bax1-I Inhibitor of apoptosis-promoting Bax1 2.5E-32 111 327

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9H3K2|GHITM_HUMAN Growth hormone-inducible transmembrane protein OS=Homo sapiens GN=GHITM PE=1 SV=2 107 334 1.0E-32
sp|Q91VC9|GHITM_MOUSE Growth hormone-inducible transmembrane protein OS=Mus musculus GN=Ghitm PE=1 SV=1 107 334 5.0E-32
sp|Q5XIA8|GHITM_RAT Growth hormone-inducible transmembrane protein OS=Rattus norvegicus GN=Ghitm PE=2 SV=1 107 334 1.0E-29
sp|Q9VSH3|BI1_DROME Probable Bax inhibitor 1 OS=Drosophila melanogaster GN=CG7188 PE=2 SV=1 174 334 2.0E-08
sp|Q0V882|BI1_BOVIN Bax inhibitor 1 OS=Bos taurus GN=TMBIM6 PE=2 SV=1 200 331 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 78 97 19
2 118 135 17
3 150 172 22
4 179 198 19
5 203 225 22
6 232 254 22
7 269 291 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6813
MLLVPGIRQGPARLAQLSKITVRSFQRPSSTGIVRPRIAVQAASRNAFSRGIAKRAYHNEALSQQQQAATDGSGM
RKLLVGGAIFGGTLLAINAVFNRETREDGGMPQYEREYLNSTFLHTGLGIGIIGLTARQMVRTGFVYRLMVTNPW
VVGIGGLALSFATMIGTRSISPDNYIPKYALWTAFNATQAAFVAPLLAFVPMPLLARAGLYTVGVMGALSVVGAT
AKQEKYLYIGGPLLAGAAVVALSGLAPLALPATAVRTLALTEKVWLYGGLAVFGGFTLYDVQKVLYHARLAQAGM
MKRDAVNESISLELDFLNIFIRMVQILMMNQGRK
Coding >Ophio5|6813
ATGTTGCTCGTGCCAGGCATCCGGCAGGGTCCCGCGCGCCTCGCGCAGCTGTCCAAGATCACAGTCCGGAGCTTC
CAGAGGCCCTCGTCGACGGGCATCGTCCGTCCCCGTATCGCCGTCCAGGCCGCTTCGCGCAACGCCTTTTCTCGC
GGCATCGCCAAGCGGGCCTATCACAATGAGGCGCTGAGCCAGCAGCAGCAGGCGGCGACGGATGGCTCCGGTATG
CGCAAGCTGCTTGTCGGGGGTGCCATTTTCGGAGGAACGCTGCTGGCGATCAACGCCGTTTTCAACCGTGAGACC
CGGGAAGACGGCGGGATGCCACAGTATGAGCGCGAATACCTCAACAGCACCTTTCTCCACACCGGTCTCGGCATC
GGAATTATCGGCTTGACGGCGAGGCAGATGGTCCGGACGGGCTTTGTGTATCGGCTGATGGTGACGAACCCGTGG
GTTGTCGGCATCGGCGGCCTCGCCCTCAGCTTTGCCACCATGATTGGGACGCGGTCCATCAGCCCTGACAACTAC
ATCCCAAAGTACGCCCTCTGGACGGCCTTTAACGCGACACAGGCCGCCTTTGTCGCACCTCTTCTCGCCTTCGTC
CCCATGCCCCTCTTGGCCCGTGCCGGCCTCTACACCGTCGGTGTCATGGGAGCCCTTTCCGTGGTGGGCGCAACG
GCCAAGCAGGAGAAGTACCTCTACATCGGCGGTCCTCTCCTGGCCGGAGCCGCCGTCGTGGCGCTGTCGGGACTG
GCTCCTCTGGCTCTGCCGGCCACGGCGGTTCGCACGCTGGCCTTGACCGAGAAGGTGTGGCTGTACGGTGGGCTG
GCCGTCTTTGGCGGCTTCACGCTGTACGACGTGCAGAAGGTGCTGTACCATGCGCGACTGGCGCAGGCTGGCATG
ATGAAGCGCGATGCGGTCAACGAGAGCATCAGCCTGGAATTGGACTTTTTGAACATATTCATACGAATGGTGCAG
ATCCTGATGATGAATCAGGGTCGGAAG
Transcript >Ophio5|6813
ATGTTGCTCGTGCCAGGCATCCGGCAGGGTCCCGCGCGCCTCGCGCAGCTGTCCAAGATCACAGTCCGGAGCTTC
CAGAGGCCCTCGTCGACGGGCATCGTCCGTCCCCGTATCGCCGTCCAGGCCGCTTCGCGCAACGCCTTTTCTCGC
GGCATCGCCAAGCGGGCCTATCACAATGAGGCGCTGAGCCAGCAGCAGCAGGCGGCGACGGATGGCTCCGGTATG
CGCAAGCTGCTTGTCGGGGGTGCCATTTTCGGAGGAACGCTGCTGGCGATCAACGCCGTTTTCAACCGTGAGACC
CGGGAAGACGGCGGGATGCCACAGTATGAGCGCGAATACCTCAACAGCACCTTTCTCCACACCGGTCTCGGCATC
GGAATTATCGGCTTGACGGCGAGGCAGATGGTCCGGACGGGCTTTGTGTATCGGCTGATGGTGACGAACCCGTGG
GTTGTCGGCATCGGCGGCCTCGCCCTCAGCTTTGCCACCATGATTGGGACGCGGTCCATCAGCCCTGACAACTAC
ATCCCAAAGTACGCCCTCTGGACGGCCTTTAACGCGACACAGGCCGCCTTTGTCGCACCTCTTCTCGCCTTCGTC
CCCATGCCCCTCTTGGCCCGTGCCGGCCTCTACACCGTCGGTGTCATGGGAGCCCTTTCCGTGGTGGGCGCAACG
GCCAAGCAGGAGAAGTACCTCTACATCGGCGGTCCTCTCCTGGCCGGAGCCGCCGTCGTGGCGCTGTCGGGACTG
GCTCCTCTGGCTCTGCCGGCCACGGCGGTTCGCACGCTGGCCTTGACCGAGAAGGTGTGGCTGTACGGTGGGCTG
GCCGTCTTTGGCGGCTTCACGCTGTACGACGTGCAGAAGGTGCTGTACCATGCGCGACTGGCGCAGGCTGGCATG
ATGAAGCGCGATGCGGTCAACGAGAGCATCAGCCTGGAATTGGACTTTTTGAACATATTCATACGAATGGTGCAG
ATCCTGATGATGAATCAGGGTCGGAAGTAG
Gene >Ophio5|6813
ATGTTGCTCGTGCCAGGCATCCGGCAGGGTCCCGCGCGCCTCGCGCAGCTGTCCAAGATCACAGTCCGGAGCTTC
CAGAGGCCCTCGTCGACGGGCATCGTCCGTCCCCGTATCGCCGTCCAGGCCGCTTCGCGCAACGCCTTTTCTCGC
GGCATCGCCAAGCGGGCCTATCACAATGAGGCGCTGAGCCAGCAGCAGCAGGCGGCGACGGATGGCTCCGGTATG
CGCAAGCTGCTTGTCGGGGGTGCCATTTTCGGAGGAACGCTGCTGGCGATCAACGCCGTTTTCAACCGTGAGACC
CGGGAAGACGGCGGGATGCCACAGTATGAGCGCGAATACCTCAACAGCACCTTTCTCCACACCGGTCTCGGCATC
GGAATTATCGGCTTGACGGCGAGGCAGATGGTCCGGACGGGCTTTGTGTATCGGCTGATGGTGACGAACCCGTGG
GTTGTCGGCATCGGCGGCCTCGCCCTCAGCTTTGCCACCATGATTGGGACGCGGTCCATCAGCCCTGACAAGTAA
GTTCTTTTGCGAGCGAGATTGTTTGAAAAGTAGCTGACGGGCTGCAACCTTGTAGCTACATCCCAAAGTACGCCC
TCTGGACGGCCTTTAACGCGACACAGGCCGCCTTTGTCGCACCTCTTCTCGCCTTCGTCCCCATGCCCCTCTTGG
CCCGTGCCGGCCTCTACACCGTCGGTGTCATGGGAGCCCTTTCCGTGGTGGGCGCAACGGCCAAGCAGGAGAAGT
ACCTCTACATCGGCGGTCCTCTCCTGGCCGGAGCCGCCGTCGTGGCGCTGTCGGGACTGGCTCCTCTGGCTCTGC
CGGCCACGGCGGTTCGCACGCTGGCCTTGACCGAGAAGGTGTGGCTGTACGGTGGGCTGGCCGTCTTTGGCGGCT
TCACGCTGTACGACGTGCAGAAGGTGCTGTACCATGCGCGACTGGCGCAGGCTGGCATGATGAAGCGCGATGCGG
TCAACGAGAGCATCAGCCTGGAATTGGACTTTTTGAACATATTCATACGAATGGTGCAGATCCTGATGATGAATC
AGGGTCGGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail