Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6811
Gene name
Locationscaffold_613:9842..10744
Strand-
Gene length (bp)902
Transcript length (bp)750
Coding sequence length (bp)747
Protein length (aa) 249

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 2.3E-19 9 205
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 7.5E-06 6 194

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P31467|YIEH_ECOLI 6-phosphogluconate phosphatase OS=Escherichia coli (strain K12) GN=yieH PE=1 SV=1 5 221 7.0E-12
sp|Q9X0Y1|P1254_THEMA Phosphorylated carbohydrates phosphatase TM_1254 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1254 PE=1 SV=1 6 232 6.0E-09
sp|Q9ZVJ5|SGGP_ARATH Haloacid dehalogenase-like hydrolase domain-containing protein Sgpp OS=Arabidopsis thaliana GN=SGPP PE=1 SV=2 6 211 8.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8586 0.456 0.114 0.0673 0.39 0.1745 0.1502 0.0266 0.0908 0.0376

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2267
Ophiocordyceps australis map64 (Brazil) OphauB2|6005
Ophiocordyceps camponoti-floridani Ophcf2|06791
Ophiocordyceps camponoti-rufipedis Ophun1|6209
Ophiocordyceps kimflemingae Ophio5|6811 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10371
Ophiocordyceps subramaniannii Hirsu2|3539
Ophiocordyceps subramaniannii Hirsu2|5668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6811
MPPRKITTLLFDCDNTLVLSEELAFEACADLINKICAERGIDKRFTGASLITEFVGQNFRGMLTTLQRENGIDIA
PDDMERYVRMEEDAVIAKLKASLRPCVGVDDQLAALADSKKYLLAVVSSSALRRVRASIEKVGQDKYFPSDKELV
FSAATSLDTPTSKPDPAVYLHALKKLGRTADESVAIEDSKSGTLSGTRAGIKVVGYVGPYPDDKKAEMEKVLRDA
GAVIIMRDWAEFPACLDKIAAGDV
Coding >Ophio5|6811
ATGCCTCCTCGAAAAATCACGACGTTGCTCTTCGATTGCGACAACACGCTCGTCCTTTCCGAGGAGCTCGCCTTC
GAAGCCTGCGCCGACCTCATCAACAAGATCTGCGCCGAGCGTGGCATCGACAAACGCTTCACGGGCGCCTCGCTC
ATCACCGAGTTCGTCGGGCAGAATTTCCGTGGCATGCTCACGACGCTGCAGCGTGAGAATGGCATCGATATCGCC
CCCGATGATATGGAGCGTTATGTTCGCATGGAGGAGGATGCCGTCATCGCTAAGCTCAAGGCTTCGCTGCGACCT
TGTGTCGGCGTCGACGATCAGCTTGCCGCCCTGGCGGATTCCAAAAAGTATCTGCTCGCCGTCGTCTCGTCGTCG
GCGCTGCGTCGTGTGCGTGCTTCCATCGAAAAGGTCGGCCAGGATAAGTACTTTCCTTCCGATAAGGAGCTCGTC
TTCTCCGCCGCCACCAGCCTCGATACGCCCACCAGCAAGCCCGATCCGGCCGTCTACCTGCACGCCCTCAAGAAG
CTGGGCCGTACCGCAGACGAGAGTGTCGCCATTGAGGATAGCAAGAGCGGCACCCTTAGCGGCACTCGTGCTGGC
ATCAAGGTCGTCGGCTACGTCGGCCCTTACCCGGATGACAAGAAGGCCGAGATGGAAAAGGTGCTCCGCGATGCG
GGCGCCGTCATCATCATGCGCGACTGGGCCGAGTTTCCCGCCTGTCTCGACAAGATTGCCGCCGGAGACGTC
Transcript >Ophio5|6811
ATGCCTCCTCGAAAAATCACGACGTTGCTCTTCGATTGCGACAACACGCTCGTCCTTTCCGAGGAGCTCGCCTTC
GAAGCCTGCGCCGACCTCATCAACAAGATCTGCGCCGAGCGTGGCATCGACAAACGCTTCACGGGCGCCTCGCTC
ATCACCGAGTTCGTCGGGCAGAATTTCCGTGGCATGCTCACGACGCTGCAGCGTGAGAATGGCATCGATATCGCC
CCCGATGATATGGAGCGTTATGTTCGCATGGAGGAGGATGCCGTCATCGCTAAGCTCAAGGCTTCGCTGCGACCT
TGTGTCGGCGTCGACGATCAGCTTGCCGCCCTGGCGGATTCCAAAAAGTATCTGCTCGCCGTCGTCTCGTCGTCG
GCGCTGCGTCGTGTGCGTGCTTCCATCGAAAAGGTCGGCCAGGATAAGTACTTTCCTTCCGATAAGGAGCTCGTC
TTCTCCGCCGCCACCAGCCTCGATACGCCCACCAGCAAGCCCGATCCGGCCGTCTACCTGCACGCCCTCAAGAAG
CTGGGCCGTACCGCAGACGAGAGTGTCGCCATTGAGGATAGCAAGAGCGGCACCCTTAGCGGCACTCGTGCTGGC
ATCAAGGTCGTCGGCTACGTCGGCCCTTACCCGGATGACAAGAAGGCCGAGATGGAAAAGGTGCTCCGCGATGCG
GGCGCCGTCATCATCATGCGCGACTGGGCCGAGTTTCCCGCCTGTCTCGACAAGATTGCCGCCGGAGACGTCTAG
Gene >Ophio5|6811
ATGCCTCCTGTACGTTGCCATCTCTGCCTCTCTCTCTCTCTCTCTCACTCTCTCTTTCTCTCTTTCTCTCTCTCT
GTCCCTCCCTCCCTCTCTCTCTCACCAGCCAGCCAAAAGCTAACAAAAAGGGGGGGCCGGGGAGCGGGACCCGGA
AAATACGGCAGCGAAAAATCACGACGTTGCTCTTCGATTGCGACAACACGCTCGTCCTTTCCGAGGAGCTCGCCT
TCGAAGCCTGCGCCGACCTCATCAACAAGATCTGCGCCGAGCGTGGCATCGACAAACGCTTCACGGGCGCCTCGC
TCATCACCGAGTTCGTCGGGCAGAATTTCCGTGGCATGCTCACGACGCTGCAGCGTGAGAATGGCATCGATATCG
CCCCCGATGATATGGAGCGTTATGTTCGCATGGAGGAGGATGCCGTCATCGCTAAGCTCAAGGCTTCGCTGCGAC
CTTGTGTCGGCGTCGACGATCAGCTTGCCGCCCTGGCGGATTCCAAAAAGTATCTGCTCGCCGTCGTCTCGTCGT
CGGCGCTGCGTCGTGTGCGTGCTTCCATCGAAAAGGTCGGCCAGGATAAGTACTTTCCTTCCGATAAGGAGCTCG
TCTTCTCCGCCGCCACCAGCCTCGATACGCCCACCAGCAAGCCCGATCCGGCCGTCTACCTGCACGCCCTCAAGA
AGCTGGGCCGTACCGCAGACGAGAGTGTCGCCATTGAGGATAGCAAGAGCGGCACCCTTAGCGGCACTCGTGCTG
GCATCAAGGTCGTCGGCTACGTCGGCCCTTACCCGGATGACAAGAAGGCCGAGATGGAAAAGGTGCTCCGCGATG
CGGGCGCCGTCATCATCATGCGCGACTGGGCCGAGTTTCCCGCCTGTCTCGACAAGATTGCCGCCGGAGACGTCT
AG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail