Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6807
Gene name
Locationscaffold_613:4027..5777
Strand-
Gene length (bp)1750
Transcript length (bp)1686
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-40 73 469
PF00083 Sugar_tr Sugar (and other) transporter 3.4E-17 71 237
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.6E-05 107 334

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 68 560 1.0E-70
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 59 551 6.0E-53
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 82 554 9.0E-44
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 3 529 4.0E-42
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 44 561 6.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 68 560 1.0E-70
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 59 551 6.0E-53
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 82 554 9.0E-44
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 3 529 4.0E-42
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 44 561 6.0E-42
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 44 561 1.0E-41
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 4 554 1.0E-41
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 74 551 3.0E-37
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 74 551 3.0E-37
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 74 546 6.0E-37
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 100 544 2.0E-35
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 36 544 3.0E-32
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 78 559 8.0E-31
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 74 479 2.0E-26
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 75 479 6.0E-24
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 82 485 3.0E-23
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 61 428 6.0E-21
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 61 428 6.0E-21
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 74 472 6.0E-19
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 74 393 8.0E-19
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 70 478 2.0E-18
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 70 388 2.0E-18
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 77 373 1.0E-17
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 72 506 2.0E-17
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 74 388 2.0E-17
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 74 388 2.0E-17
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 74 388 2.0E-17
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 74 388 2.0E-17
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 74 388 2.0E-17
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 74 388 2.0E-17
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 74 388 2.0E-17
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 74 388 2.0E-17
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 74 368 4.0E-17
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 74 368 4.0E-17
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 72 515 7.0E-17
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 95 502 3.0E-16
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 26 485 2.0E-15
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 55 386 3.0E-15
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 82 230 6.0E-15
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 74 368 1.0E-14
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 72 468 1.0E-14
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 74 472 1.0E-14
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 16 524 5.0E-14
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 155 479 8.0E-14
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 52 401 8.0E-14
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 3 479 1.0E-13
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 58 388 1.0E-13
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 74 483 1.0E-12
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 73 450 2.0E-12
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 74 368 2.0E-12
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 74 378 3.0E-12
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 80 388 6.0E-12
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 27 560 9.0E-12
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 21 497 2.0E-11
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 27 554 2.0E-11
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 70 497 3.0E-11
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 122 546 7.0E-11
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 103 328 8.0E-11
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 74 473 1.0E-10
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 14 479 2.0E-10
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 74 372 2.0E-10
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 74 287 2.0E-10
sp|P62967|TCR_STAES Tetracycline resistance protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tet PE=3 SV=1 73 463 2.0E-10
sp|P02983|TCR_STAAU Tetracycline resistance protein OS=Staphylococcus aureus GN=tet PE=3 SV=3 73 463 2.0E-10
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 74 287 2.0E-10
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 63 472 2.0E-10
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 63 472 2.0E-10
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 74 372 3.0E-10
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 74 372 3.0E-10
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 74 287 3.0E-10
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 74 480 3.0E-10
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 74 372 3.0E-10
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 61 368 3.0E-10
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 104 353 4.0E-10
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 61 368 4.0E-10
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 74 287 4.0E-10
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 74 372 4.0E-10
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 74 372 5.0E-10
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 74 287 5.0E-10
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 74 287 5.0E-10
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 74 287 5.0E-10
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 46 384 8.0E-10
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 46 384 8.0E-10
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 74 287 8.0E-10
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 74 287 1.0E-09
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 74 372 2.0E-09
sp|Q8FDU9|NANT2_ECOL6 Putative sialic acid transporter 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT2 PE=3 SV=1 45 235 4.0E-09
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 70 368 5.0E-09
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 74 372 5.0E-09
sp|Q04602|VBA4_YEAST Vacuolar basic amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA4 PE=1 SV=1 8 243 7.0E-09
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 78 221 7.0E-09
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 36 490 1.0E-08
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 74 388 1.0E-08
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 61 488 2.0E-08
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 74 372 3.0E-08
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 75 353 4.0E-08
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 103 386 4.0E-08
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 74 388 6.0E-08
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 51 246 3.0E-07
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 121 246 4.0E-07
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 73 451 4.0E-07
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 57 472 4.0E-07
sp|A7MJD1|NANT_CROS8 Putative sialic acid transporter OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nanT PE=3 SV=1 72 235 5.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 73 451 6.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 73 451 6.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 73 451 6.0E-07
sp|A9MNY7|NANT_SALAR Putative sialic acid transporter OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|C0PZN3|NANT_SALPC Putative sialic acid transporter OS=Salmonella paratyphi C (strain RKS4594) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|Q57JD0|NANT_SALCH Putative sialic acid transporter OS=Salmonella choleraesuis (strain SC-B67) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|P0A2G5|NANT_SALTY Putative sialic acid transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|P0A2G6|NANT_SALTI Putative sialic acid transporter OS=Salmonella typhi GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|A9N832|NANT_SALPB Putative sialic acid transporter OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|B4T749|NANT_SALNS Putative sialic acid transporter OS=Salmonella newport (strain SL254) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|B5RET6|NANT_SALG2 Putative sialic acid transporter OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|B5R0L1|NANT_SALEP Putative sialic acid transporter OS=Salmonella enteritidis PT4 (strain P125109) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|B5FIR7|NANT_SALDC Putative sialic acid transporter OS=Salmonella dublin (strain CT_02021853) GN=nanT PE=3 SV=1 72 235 8.0E-07
sp|B5BGP4|NANT_SALPK Putative sialic acid transporter OS=Salmonella paratyphi A (strain AKU_12601) GN=nanT PE=3 SV=1 72 235 9.0E-07
sp|Q5PLF0|NANT_SALPA Putative sialic acid transporter OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nanT PE=3 SV=1 72 235 9.0E-07
sp|B4TJR2|NANT_SALHS Putative sialic acid transporter OS=Salmonella heidelberg (strain SL476) GN=nanT PE=3 SV=1 72 235 9.0E-07
sp|B4TWI9|NANT_SALSV Putative sialic acid transporter OS=Salmonella schwarzengrund (strain CVM19633) GN=nanT PE=3 SV=1 72 235 9.0E-07
sp|B5F7J8|NANT_SALA4 Putative sialic acid transporter OS=Salmonella agona (strain SL483) GN=nanT PE=3 SV=1 72 235 9.0E-07
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 121 246 1.0E-06
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 121 236 1.0E-06
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 72 235 2.0E-06
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 29 252 3.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 105 481 3.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 105 481 3.0E-06
sp|A8AQB4|NANT_CITK8 Putative sialic acid transporter OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nanT PE=3 SV=1 72 235 3.0E-06
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 72 246 3.0E-06
sp|A8A534|NANT_ECOHS Putative sialic acid transporter OS=Escherichia coli O9:H4 (strain HS) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|P41036|NANT_ECOLI Putative sialic acid transporter OS=Escherichia coli (strain K12) GN=nanT PE=1 SV=2 72 235 4.0E-06
sp|B1XHJ7|NANT_ECODH Putative sialic acid transporter OS=Escherichia coli (strain K12 / DH10B) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|C4ZSW2|NANT_ECOBW Putative sialic acid transporter OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|Q0TCP2|NANT_ECOL5 Putative sialic acid transporter OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|Q8NLB7|GENK_CORGL Gentisate transporter OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=genK PE=1 SV=2 64 259 4.0E-06
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|Q8FD59|NANT1_ECOL6 Putative sialic acid transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanT1 PE=3 SV=2 72 235 4.0E-06
sp|P59699|NANT_SHIFL Putative sialic acid transporter OS=Shigella flexneri GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|Q0T066|NANT_SHIF8 Putative sialic acid transporter OS=Shigella flexneri serotype 5b (strain 8401) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|B2U1W0|NANT_SHIB3 Putative sialic acid transporter OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|B1IQQ5|NANT_ECOLC Putative sialic acid transporter OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|B7M0T6|NANT_ECO8A Putative sialic acid transporter OS=Escherichia coli O8 (strain IAI1) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|B7LHS8|NANT_ECO55 Putative sialic acid transporter OS=Escherichia coli (strain 55989 / EAEC) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|B5YSV1|NANT_ECO5E Putative sialic acid transporter OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|Q8X9G8|NANT_ECO57 Putative sialic acid transporter OS=Escherichia coli O157:H7 GN=nanT PE=3 SV=2 72 235 4.0E-06
sp|B7MBY6|NANT_ECO45 Putative sialic acid transporter OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nanT PE=3 SV=1 72 235 4.0E-06
sp|B1LGI9|NANT_ECOSM Putative sialic acid transporter OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanT PE=3 SV=1 72 235 5.0E-06
sp|B6I1U2|NANT_ECOSE Putative sialic acid transporter OS=Escherichia coli (strain SE11) GN=nanT PE=3 SV=1 72 235 5.0E-06
sp|B7NKT5|NANT_ECO7I Putative sialic acid transporter OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nanT PE=3 SV=1 72 235 5.0E-06
sp|B7UJV7|NANT_ECO27 Putative sialic acid transporter OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nanT PE=3 SV=1 72 235 5.0E-06
sp|A7ZSB7|NANT_ECO24 Putative sialic acid transporter OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nanT PE=3 SV=1 72 235 5.0E-06
sp|O34367|YTBD_BACSU Uncharacterized MFS-type transporter YtbD OS=Bacillus subtilis (strain 168) GN=ytbD PE=3 SV=1 119 293 5.0E-06
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 120 246 6.0E-06
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 73 451 6.0E-06
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 77 371 6.0E-06
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 121 233 7.0E-06
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 74 372 8.0E-06
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 106 234 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 100 122 22
3 132 151 19
4 158 180 22
5 190 212 22
6 254 276 22
7 286 308 22
8 329 351 22
9 366 383 17
10 390 409 19
11 424 446 22
12 459 481 22
13 527 549 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6807
MPSDGIRNHHERSPLLQPVGPDQPTARQAETAPSPQPVNGDGHDDDDDDDDERTVVASQLPLPRLAFIMGTAWLG
VFLGAIDSTVIATLSASIASEFKSLSLLSWLATAYLISTAACQPISGRLTDIFGRGPGLIFSNIFFAAGNVICGL
ARNDSVMILGRVIAGIGGGGLMSISTFLGSDLIPLRNRGIAQGIGNICYGSGAMLGSVFGGLMNDHTRWGWRLAF
LVQAPPVLFSAVAAAVLIKVPPKQSKKSFLARIDFVGVLLTTSFLVLLLLGLNSGGNQVPWTHPLPLVTIPLSIL
VFAGFLWWESRARQPIIPVRLLMIRTVLAACMCNLLCTMVVMAGIFHVPLYLQVLGDSATGAGLKVLPSPLGVSI
FSVGAGYLMKRTGRYYWLGISSIVILILGVVIFTLQGKDQPLWQSSVAFFFVGGGYGAMLTVTLLACVAAVQHSQ
QAVVTSATYLGRSVGGTVGITLGSAVYQNLLKNGLWARFGHLPGAEDEIRRIRNDLGELKRLPAGWHDGVIDSFM
EAFRGVWLVMLAISVGALVSISMMRHHTLHATLERR
Coding >Ophio5|6807
ATGCCCTCGGACGGAATCCGGAACCATCATGAGCGCTCTCCGCTTCTGCAGCCGGTAGGCCCGGACCAGCCTACG
GCTCGCCAAGCCGAGACGGCTCCGAGTCCGCAGCCGGTGAACGGCGATGGTCATGACGACGACGACGACGACGAC
GACGAGCGTACCGTCGTCGCCAGTCAGCTCCCGCTGCCGAGACTTGCCTTCATCATGGGCACCGCCTGGCTGGGC
GTCTTCCTCGGCGCCATCGACAGCACCGTCATCGCAACGCTTTCGGCTTCGATTGCGAGCGAGTTCAAGTCGCTG
AGCCTGCTATCCTGGCTCGCCACCGCCTACCTCATCTCTACTGCGGCATGCCAGCCTATCTCGGGCAGGCTGACG
GATATTTTCGGCCGCGGGCCCGGCCTCATCTTTAGCAACATCTTCTTCGCTGCCGGGAACGTTATCTGCGGGCTA
GCACGAAACGATAGCGTTATGATCCTCGGTCGGGTTATCGCCGGTATTGGCGGCGGCGGCCTTATGAGCATATCT
ACCTTCCTAGGCTCCGATCTGATTCCCCTACGCAACCGGGGCATCGCGCAGGGTATTGGAAATATCTGCTACGGA
TCCGGCGCGATGCTAGGTAGCGTCTTTGGAGGGTTGATGAACGATCATACCCGTTGGGGATGGAGGCTGGCCTTT
CTGGTCCAGGCGCCCCCCGTGCTATTCTCCGCCGTCGCTGCGGCGGTCCTGATCAAGGTGCCGCCAAAGCAATCT
AAGAAGTCGTTTCTGGCGCGCATCGATTTCGTCGGCGTCTTGCTCACCACGTCCTTTCTCGTCCTGCTGCTCCTA
GGGCTCAACTCGGGCGGGAACCAGGTGCCGTGGACGCACCCGCTACCGCTGGTGACGATACCTCTATCCATTCTC
GTCTTCGCCGGCTTCCTCTGGTGGGAGAGCAGAGCACGGCAGCCCATCATCCCCGTCAGGCTGTTGATGATACGC
ACCGTCCTGGCCGCCTGCATGTGCAACCTGCTCTGCACCATGGTAGTCATGGCTGGCATCTTCCATGTGCCGCTC
TATCTCCAGGTGTTGGGCGACTCGGCCACCGGGGCAGGGCTCAAGGTGCTGCCGTCGCCGCTTGGCGTGTCCATC
TTCTCGGTGGGCGCAGGGTACTTGATGAAGCGGACGGGCCGCTACTACTGGCTGGGCATCTCCAGTATTGTCATC
CTTATCCTCGGCGTCGTCATCTTCACCCTGCAAGGCAAGGACCAGCCACTGTGGCAGAGCAGCGTGGCCTTTTTC
TTCGTCGGCGGCGGTTACGGCGCCATGTTGACGGTGACGTTACTGGCCTGCGTCGCGGCCGTCCAACATTCACAG
CAGGCCGTCGTCACGTCGGCTACGTATCTGGGGAGAAGCGTGGGCGGCACCGTCGGCATCACTCTCGGCTCTGCC
GTATATCAGAACCTACTCAAGAACGGGCTATGGGCCAGATTCGGTCACCTCCCGGGCGCCGAGGATGAGATTCGT
CGGATCCGCAACGATCTGGGCGAGCTGAAGCGGCTTCCTGCGGGCTGGCATGACGGTGTTATCGACTCTTTCATG
GAGGCTTTCCGAGGCGTGTGGCTGGTGATGCTAGCAATTTCCGTGGGAGCACTGGTGAGCATCTCGATGATGCGC
CATCACACGTTGCACGCAACGCTGGAGCGGCGT
Transcript >Ophio5|6807
ATGCCCTCGGACGGAATCCGGAACCATCATGAGCGCTCTCCGCTTCTGCAGCCGGTAGGCCCGGACCAGCCTACG
GCTCGCCAAGCCGAGACGGCTCCGAGTCCGCAGCCGGTGAACGGCGATGGTCATGACGACGACGACGACGACGAC
GACGAGCGTACCGTCGTCGCCAGTCAGCTCCCGCTGCCGAGACTTGCCTTCATCATGGGCACCGCCTGGCTGGGC
GTCTTCCTCGGCGCCATCGACAGCACCGTCATCGCAACGCTTTCGGCTTCGATTGCGAGCGAGTTCAAGTCGCTG
AGCCTGCTATCCTGGCTCGCCACCGCCTACCTCATCTCTACTGCGGCATGCCAGCCTATCTCGGGCAGGCTGACG
GATATTTTCGGCCGCGGGCCCGGCCTCATCTTTAGCAACATCTTCTTCGCTGCCGGGAACGTTATCTGCGGGCTA
GCACGAAACGATAGCGTTATGATCCTCGGTCGGGTTATCGCCGGTATTGGCGGCGGCGGCCTTATGAGCATATCT
ACCTTCCTAGGCTCCGATCTGATTCCCCTACGCAACCGGGGCATCGCGCAGGGTATTGGAAATATCTGCTACGGA
TCCGGCGCGATGCTAGGTAGCGTCTTTGGAGGGTTGATGAACGATCATACCCGTTGGGGATGGAGGCTGGCCTTT
CTGGTCCAGGCGCCCCCCGTGCTATTCTCCGCCGTCGCTGCGGCGGTCCTGATCAAGGTGCCGCCAAAGCAATCT
AAGAAGTCGTTTCTGGCGCGCATCGATTTCGTCGGCGTCTTGCTCACCACGTCCTTTCTCGTCCTGCTGCTCCTA
GGGCTCAACTCGGGCGGGAACCAGGTGCCGTGGACGCACCCGCTACCGCTGGTGACGATACCTCTATCCATTCTC
GTCTTCGCCGGCTTCCTCTGGTGGGAGAGCAGAGCACGGCAGCCCATCATCCCCGTCAGGCTGTTGATGATACGC
ACCGTCCTGGCCGCCTGCATGTGCAACCTGCTCTGCACCATGGTAGTCATGGCTGGCATCTTCCATGTGCCGCTC
TATCTCCAGGTGTTGGGCGACTCGGCCACCGGGGCAGGGCTCAAGGTGCTGCCGTCGCCGCTTGGCGTGTCCATC
TTCTCGGTGGGCGCAGGGTACTTGATGAAGCGGACGGGCCGCTACTACTGGCTGGGCATCTCCAGTATTGTCATC
CTTATCCTCGGCGTCGTCATCTTCACCCTGCAAGGCAAGGACCAGCCACTGTGGCAGAGCAGCGTGGCCTTTTTC
TTCGTCGGCGGCGGTTACGGCGCCATGTTGACGGTGACGTTACTGGCCTGCGTCGCGGCCGTCCAACATTCACAG
CAGGCCGTCGTCACGTCGGCTACGTATCTGGGGAGAAGCGTGGGCGGCACCGTCGGCATCACTCTCGGCTCTGCC
GTATATCAGAACCTACTCAAGAACGGGCTATGGGCCAGATTCGGTCACCTCCCGGGCGCCGAGGATGAGATTCGT
CGGATCCGCAACGATCTGGGCGAGCTGAAGCGGCTTCCTGCGGGCTGGCATGACGGTGTTATCGACTCTTTCATG
GAGGCTTTCCGAGGCGTGTGGCTGGTGATGCTAGCAATTTCCGTGGGAGCACTGGTGAGCATCTCGATGATGCGC
CATCACACGTTGCACGCAACGCTGGAGCGGCGTTGA
Gene >Ophio5|6807
ATGCCCTCGGACGGAATCCGGAACCATCATGAGCGCTCTCCGCTTCTGCAGCCGGTAGGCCCGGACCAGCCTACG
GCTCGCCAAGCCGAGACGGCTCCGAGTCCGCAGCCGGTGAACGGCGATGGTCATGACGACGACGACGACGACGAC
GACGAGCGTACCGTCGTCGCCAGTCAGCTCCCGCTGCCGAGACTTGCCTTCATCATGGGCACCGCCTGGCTGGGC
GTCTTCCTCGGCGCCATCGACAGCACCGTCATCGCAACGCTTTCGGCTTCGATTGCGAGCGAGTTCAAGTCGCTG
AGCCTGCTATCCTGGCTCGCCACCGCCTACCTCATCTCTACTGCGGCATGCCAGCCTATCTCGGGCAGGCTGACG
GATATTTTCGGCCGCGGGCCCGGCCTCATCTTTAGCAACATCTTCTTCGCTGCCGGGAACGTTATCTGCGGGCTA
GCACGAAACGATAGCGTTATGATCCTCGGTCGGGTTATCGCCGGTATTGGCGGCGGCGGCCTTATGAGCATATCT
ACCTTCCTAGGCTCCGATCTGATTCCCCTACGCAACCGGGGCATCGCGCAGGGTATTGGAAATATCTGCTACGGA
TCCGGCGCGATGCTAGGTAGCGTCTTTGGAGGGTTGATGAACGATCATACCCGTTGGGGATGGAGGCTGGCCTTT
CTGGTCCAGGCGCCCCCCGTGCTATTCTCCGCCGTCGCTGCGGCGGTCCTGATCAAGGTGCCGCCAAAGCAATCT
AAGAAGTCGTTTCTGGCGCGCATCGATTTCGTCGGCGTCTTGCTCACCACGTCCTTTCTCGTCCTGCTGCTCCTA
GGGCTCAACTCGGGCGGGAACCAGGTGCCGTGGACGCACCCGCTACCGCTGGTGACGATACCTCTATCCATTCTC
GTCTTCGCCGGCTTCCTCTGGTGGGAGAGCAGAGCACGGCAGCCCATCATCCCCGTCAGGCTGTTGATGATACGC
ACCGTCCTGGCCGCCTGCATGTGCAACCTGCTCTGCACCATGGTAGTCATGGCTGGCATCTTCCATGTGCCGCTC
TATCTCCAGGTGTTGGGCGACTCGGCCACCGGGGCAGGGCTCAAGGTGCTGCCGTCGCCGCTTGGCGTGTCCATC
TTCTCGGTGGGCGCAGGGTACTTGATGAAGCGGACGGGCCGCTACTACTGGCTGGGCATCTCCAGTATTGTCATC
CTTATCCTCGGCGTCGTCATCTTCACCCTGCAAGGCAAGGACCAGCCACTGTGGCAGAGCAGCGTGGCCTTTTTC
TTCGTCGGCGGCGGTTACGGCGCCATGTTGACGGTGACGTTACTGGCCTGCGTCGCGGCCGTCCAACATTCACAG
CAGGCCGTCGTCACGTCGGCTACGTGTAAGTTGTGATGCCCCTAATTAGTACGTGACCTGCGTGCTCGTGCTGAC
GAAGCCGTGCCAAGATCTGGGGAGAAGCGTGGGCGGCACCGTCGGCATCACTCTCGGCTCTGCCGTATATCAGAA
CCTACTCAAGAACGGGCTATGGGCCAGATTCGGTCACCTCCCGGGCGCCGAGGATGAGATTCGTCGGATCCGCAA
CGATCTGGGCGAGCTGAAGCGGCTTCCTGCGGGCTGGCATGACGGTGTTATCGACTCTTTCATGGAGGCTTTCCG
AGGCGTGTGGCTGGTGATGCTAGCAATTTCCGTGGGAGCACTGGTGAGCATCTCGATGATGCGCCATCACACGTT
GCACGCAACGCTGGAGCGGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail