Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6795
Gene name
Locationscaffold_611:2997..4491
Strand-
Gene length (bp)1494
Transcript length (bp)1323
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.7E-37 72 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 48 421 3.0E-23
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 48 409 1.0E-22
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 55 421 6.0E-21
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 47 421 6.0E-21
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 55 409 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 48 421 3.0E-23
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 48 409 1.0E-22
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 55 421 6.0E-21
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 47 421 6.0E-21
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 55 409 1.0E-20
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 37 406 1.0E-17
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 52 409 1.0E-16
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 52 409 5.0E-16
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 52 409 1.0E-15
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 73 409 9.0E-15
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 54 412 4.0E-14
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 73 421 5.0E-14
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 73 421 5.0E-14
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 9 421 5.0E-14
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 73 421 8.0E-14
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 106 408 2.0E-12
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 67 400 4.0E-12
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 67 400 5.0E-12
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 67 400 5.0E-12
sp|O13340|CARP_PODAS Podosporapepsin OS=Podospora anserina GN=PAPA PE=2 SV=1 73 403 6.0E-12
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 73 409 2.0E-11
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 73 409 2.0E-11
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 112 409 5.0E-11
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 67 400 6.0E-11
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 112 409 2.0E-10
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 73 411 2.0E-10
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 53 420 4.0E-10
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 73 409 5.0E-10
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 52 408 7.0E-10
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 44 408 1.0E-09
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 73 422 2.0E-09
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 73 399 2.0E-09
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 67 242 3.0E-09
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 54 412 6.0E-09
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 67 244 1.0E-08
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 67 268 2.0E-08
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 72 401 2.0E-08
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 67 243 3.0E-08
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 48 244 3.0E-08
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 48 244 4.0E-08
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 67 411 4.0E-08
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 66 268 5.0E-08
sp|Q06325|YPS7_YEAST Aspartic proteinase yapsin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS7 PE=1 SV=1 224 406 8.0E-08
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 62 242 1.0E-07
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 72 401 2.0E-07
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 67 243 3.0E-07
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 52 408 5.0E-07
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 66 243 5.0E-07
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 73 243 7.0E-07
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 67 268 8.0E-07
sp|Q6DLW5|RENI_MACMU Renin OS=Macaca mulatta GN=REN PE=2 SV=2 67 250 8.0E-07
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 66 243 8.0E-07
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 67 409 8.0E-07
sp|P00797|RENI_HUMAN Renin OS=Homo sapiens GN=REN PE=1 SV=1 67 268 8.0E-07
sp|P60016|RENI_PANTR Renin OS=Pan troglodytes GN=REN PE=3 SV=1 67 268 8.0E-07
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 67 243 8.0E-07
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 65 243 8.0E-07
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 73 268 9.0E-07
sp|P11838|CARP_CRYPA Endothiapepsin OS=Cryphonectria parasitica GN=EAPA PE=1 SV=2 67 400 9.0E-07
sp|A2R3L3|PEPA_ASPNC Aspartic protease pep1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pep1 PE=3 SV=1 71 402 1.0E-06
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 67 268 1.0E-06
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 66 243 1.0E-06
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 66 243 1.0E-06
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 66 241 2.0E-06
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 69 243 2.0E-06
sp|Q9TSZ1|RENI_CALJA Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 67 243 2.0E-06
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 69 268 5.0E-06
sp|P39898|PLM1_PLAFA Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 66 247 7.0E-06
sp|Q7KQM4|PLM1_PLAF7 Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 66 247 7.0E-06
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 66 241 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 13.94 5.66 22.21
CcL In ants, during behavior modification 75.02 22.69 127.35
CcD In ants, recently dead 6.92 2.04 11.81

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.032183 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6795
MKSPSPGSLFIHGMLLLATYASAIRVDDDALESVPGTVSMSLGFSHNDNAGGLTINKRQVGVSLHRDLLKRQYNV
EISIGSPRQTLLLPLDMASDVLWVKEKPTSQPGTTGFDIKKSATLKPLNYHWQMKYPQNDCAIIRFDSYRDNATV
GSIIVKDLIFATAPEQRSVGANFGGVDGVFGLGLQWEGNRETPIPSSNSLMKALLDQQAIYRRVFSLNLQESDSH
DGLVLLGGLDSKKYSGNLVKQRTIKGKNSDSCQHEGASACENGYVIPVKRITTTSPWHQPVTVADTPRGEPYLLD
SSSTINFFSQTVIQRILEQFPGARPVEGLPLFEIDCQPRMIKGSIDFTIGDAVIKVPNRDFIWHIKPLPGRCFLP
MMDSKEAGCNVLGQPFLSAAYVVIDQDNRDVYLGNKADCGSNEVALRPSDRIDRQFGECPESSGD
Coding >Ophio5|6795
ATGAAGTCTCCATCTCCCGGAAGCCTCTTCATTCACGGAATGCTGCTCCTCGCAACTTACGCCTCCGCCATCCGG
GTAGACGACGATGCCTTAGAATCTGTACCTGGAACAGTTTCGATGTCGCTGGGGTTTTCTCATAACGACAACGCT
GGCGGATTAACGATCAACAAGCGTCAGGTCGGTGTTAGTTTGCATCGTGATTTGCTCAAGCGACAGTACAACGTC
GAAATTAGCATTGGCTCCCCTAGACAGACCTTGTTGCTTCCTCTCGACATGGCCTCGGACGTCCTATGGGTCAAG
GAGAAGCCAACGTCCCAGCCTGGCACAACCGGTTTCGATATTAAAAAAAGCGCGACGCTCAAACCGCTCAACTAT
CACTGGCAGATGAAGTATCCGCAAAATGACTGCGCCATAATTCGGTTCGATAGTTACCGAGATAACGCGACAGTT
GGCTCGATCATCGTCAAAGATTTAATCTTCGCCACGGCGCCAGAGCAACGCTCTGTGGGTGCAAACTTTGGCGGA
GTTGATGGTGTCTTCGGACTCGGTCTACAGTGGGAAGGGAATCGCGAAACACCCATTCCATCCTCGAACTCGCTC
ATGAAGGCCTTATTGGATCAGCAAGCAATCTACAGACGAGTATTCAGTCTCAACCTACAGGAGAGCGATAGTCAC
GACGGCCTAGTTCTCCTGGGCGGCCTTGACTCGAAAAAGTATTCTGGCAACCTTGTGAAGCAGCGCACTATCAAG
GGGAAGAATTCAGATAGCTGCCAACACGAGGGAGCATCGGCCTGCGAAAACGGCTATGTGATTCCTGTCAAACGA
ATTACCACCACCTCACCCTGGCATCAACCTGTCACTGTCGCAGACACGCCGCGGGGGGAACCATATCTTCTCGAT
AGCTCCAGCACTATCAACTTCTTCTCCCAGACTGTTATTCAAAGAATCCTAGAACAATTCCCGGGCGCTCGACCC
GTCGAGGGCTTGCCCCTGTTCGAGATTGATTGCCAGCCTCGCATGATAAAGGGTTCCATCGACTTCACCATAGGG
GATGCAGTTATCAAAGTTCCCAACCGGGACTTCATCTGGCATATTAAACCCTTGCCAGGCCGTTGCTTTCTGCCC
ATGATGGACAGCAAGGAAGCTGGCTGCAACGTGCTGGGTCAACCGTTCCTAAGCGCGGCATACGTGGTGATTGAT
CAAGACAATCGTGATGTTTATCTGGGGAACAAAGCCGACTGCGGATCGAACGAGGTGGCACTGCGGCCCAGCGAT
CGGATAGACCGGCAGTTTGGGGAATGTCCGGAATCATCAGGTGAT
Transcript >Ophio5|6795
ATGAAGTCTCCATCTCCCGGAAGCCTCTTCATTCACGGAATGCTGCTCCTCGCAACTTACGCCTCCGCCATCCGG
GTAGACGACGATGCCTTAGAATCTGTACCTGGAACAGTTTCGATGTCGCTGGGGTTTTCTCATAACGACAACGCT
GGCGGATTAACGATCAACAAGCGTCAGGTCGGTGTTAGTTTGCATCGTGATTTGCTCAAGCGACAGTACAACGTC
GAAATTAGCATTGGCTCCCCTAGACAGACCTTGTTGCTTCCTCTCGACATGGCCTCGGACGTCCTATGGGTCAAG
GAGAAGCCAACGTCCCAGCCTGGCACAACCGGTTTCGATATTAAAAAAAGCGCGACGCTCAAACCGCTCAACTAT
CACTGGCAGATGAAGTATCCGCAAAATGACTGCGCCATAATTCGGTTCGATAGTTACCGAGATAACGCGACAGTT
GGCTCGATCATCGTCAAAGATTTAATCTTCGCCACGGCGCCAGAGCAACGCTCTGTGGGTGCAAACTTTGGCGGA
GTTGATGGTGTCTTCGGACTCGGTCTACAGTGGGAAGGGAATCGCGAAACACCCATTCCATCCTCGAACTCGCTC
ATGAAGGCCTTATTGGATCAGCAAGCAATCTACAGACGAGTATTCAGTCTCAACCTACAGGAGAGCGATAGTCAC
GACGGCCTAGTTCTCCTGGGCGGCCTTGACTCGAAAAAGTATTCTGGCAACCTTGTGAAGCAGCGCACTATCAAG
GGGAAGAATTCAGATAGCTGCCAACACGAGGGAGCATCGGCCTGCGAAAACGGCTATGTGATTCCTGTCAAACGA
ATTACCACCACCTCACCCTGGCATCAACCTGTCACTGTCGCAGACACGCCGCGGGGGGAACCATATCTTCTCGAT
AGCTCCAGCACTATCAACTTCTTCTCCCAGACTGTTATTCAAAGAATCCTAGAACAATTCCCGGGCGCTCGACCC
GTCGAGGGCTTGCCCCTGTTCGAGATTGATTGCCAGCCTCGCATGATAAAGGGTTCCATCGACTTCACCATAGGG
GATGCAGTTATCAAAGTTCCCAACCGGGACTTCATCTGGCATATTAAACCCTTGCCAGGCCGTTGCTTTCTGCCC
ATGATGGACAGCAAGGAAGCTGGCTGCAACGTGCTGGGTCAACCGTTCCTAAGCGCGGCATACGTGGTGATTGAT
CAAGACAATCGTGATGTTTATCTGGGGAACAAAGCCGACTGCGGATCGAACGAGGTGGCACTGCGGCCCAGCGAT
CGGATAGACCGGCAGTTTGGGGAATGTCCGGAATCATCAGGTGATTGA
Gene >Ophio5|6795
ATGAAGTCTCCATCTCCCGGAAGCCTCTTCATTCACGGAATGCTGCTCCTCGCAACTTACGCCTCCGCCATCCGG
GTAGACGACGATGCCTTAGAATCTGTACCTGGAACAGTTTCGATGTCGCTGGGGTTTTCTCATAACGACAACGCT
GGCGGATTAACGATCAACAAGCGTCAGGTCGGTGTTAGTTTGCATCGTGATTTGCTCAAGCGACAGTACAACGTC
GAAATTAGCATTGGCTCCCCTAGACAGACCTTGTTGCTTCCTCTCGACATGGCCTCGGACGTCCTATGGGTCAAG
GAGAAGCCAACGTCCCAGCCTGGCACAACCGGTTTCGATATTAAAAAAAGCGCGACGCTCAAACCGCTCAACTAT
CACTGGCAGATGAAGTATCCGCAAAATGACTGCGCCATAATTCGGTTCGATAGTTACCGAGATAACGCGACAGTT
GGTAGGTGGAACACCACAGATGTAACGCTCAACTTACTAGGGGCTGACGCAGAGGTACGAATTGCAGGCTCGATC
ATCGTCAAAGATTTAATCTTCGCCACGGCGCCAGAGCAACGCTCTGTGGGTGCAAACTTTGGCGGAGTTGATGGT
GTCTTCGGACTCGGTCTACAGTGGGAAGGGAATCGCGAAACACCCATTCCATCCTCGAACTCGCTCATGAAGGCC
TTATTGGATCAGCAAGCAATCTACAGACGAGTATTCAGTCTCAACCTACAGGAGAGCGATAGTCACGACGGCCTA
GTTCTCCTGGGCGGCCTTGACTCGAAAAAGTATTCTGGCAACCTTGTGAAGCAGCGCACTATCAAGGGGAAGAAT
TCAGATAGCTGCCAACACGAGGGAGCATCGGCCTGCGAAAACGGGTGAGTCAAGAAGGCCTCGTTGGGCGCAAAT
CTTCACTCACCCGGTGCTAGCTATGTGATTCCTGTCAAACGAATTACCACCACCTCACCCTGGCATCAACCTGTC
ACTGTCGCAGACACGCCGCGGGGGGAACCATATCTTCTCGATAGCTCCAGCACTATCAACTTCTTCTCCCAGACT
GTTATTCAAAGAATCCTAGAACAATTCCCGGGCGCTCGACCCGTCGAGGGCTTGCCCCTGTTCGAGATTGATTGC
CAGCCTCGCATGATAAAGGGTTCCATCGACTTCACCATAGGGGATGCAGTTATCAAAGTTCCCAACCGGGACTTC
ATCTGGCATATTAAACCCTTGCCAGGCCGTTGCTTTCTGCCCATGATGGACAGCAAGGGTACGTTAGTCGATCTT
TTGTCAACCGAATCAGATGTGCTCACTCTTCGAGCAGAAGCTGGCTGCAACGTGCTGGGTCAACCGTTCCTAAGC
GCGGCATACGTGGTGATTGATCAAGACAATCGTGATGTTTATCTGGGGAACAAAGCCGACTGCGGATCGAACGAG
GTGGCACTGCGGCCCAGCGATCGGATAGACCGGCAGTTTGGGGAATGTCCGGAATCATCAGGTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail