Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|679
Gene name
Locationscaffold_1184:108..2465
Strand+
Gene length (bp)2357
Transcript length (bp)2175
Coding sequence length (bp)2172
Protein length (aa) 724

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19031 Intu_longin_1 First Longin domain of INTU, CCZ1 and HPS4 2.1E-05 19 129

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|679
MASGAASSSGAVVPARLGFLAIYNPSLGRTDETMDEQIVYYASVTTQAASSHRRRRRRVRARARPTDGLTPQERH
ERLRQIGLAQGMVSFGRGFADGAAVDAIDTDGARVVVHELEPGWWILASIDLTKMPLPPRLVNSAAEDSRFEYSS
REMKPASLLVGDLLRAHNIFLMHHGSSLSGLFVHCRRSKFVALLGRYWDLFLSTWNVLLHGNPARDMFGAINVAA
SGELGVGVGEEDRGSGEREVLEGLVGRIEGLVDLVVSKFGTDEDESEQDVSWLGTGREPAADDGAVFLGVGALSR
KSLRDVTHWMEDLYTWGEHAYGVIESPTSVRRAGARCGSAAAHEDGAATEEPSAGAEDKAPPAESKTAASKPAGQ
ADGRQWTKNAVAAADDGRLDKMLSYMKLGYGSYWTLPGATSQGTASRQPSSSRRPAPPKRTSSAGRFLIGLTGQM
EETDDDGDAASSGCSEAEHNSRTVLRTVHVELESDGTRPEMTMVKDFVNPVSERQVAYSSYDVNKTDKLRVVIYV
NRPFVFAFFFRLRTDSLAWDTLYRSLHYQLAPLRRPLLASTRYRPPSSQPPGGLYSLVWDPASLTVRAAVPNIPD
QQQLRLGGGHSSLLDAFWSRADAVSTHLQLLLLQAATRSVTGTVERTLKTSRGWWIVWTRLGHGDDDDDDDCSAS
GPGLPAKEIFLIRRASDHAGAADAVAAAGLVQGIGVDTRRYVEELLSLL
Coding >Ophio5|679
ATGGCCTCGGGCGCTGCCTCGTCTTCGGGGGCCGTCGTCCCCGCCCGCCTCGGCTTCCTAGCTATCTACAACCCA
TCGCTGGGCAGGACGGACGAGACGATGGACGAGCAGATCGTCTACTATGCCTCGGTCACGACGCAAGCCGCCTCG
TCTCATCGTCGACGCCGGCGTCGTGTCCGAGCTCGAGCTCGTCCGACGGACGGACTCACGCCCCAAGAGCGCCAT
GAGCGTCTGCGTCAGATCGGCTTGGCTCAGGGCATGGTCAGCTTTGGTCGTGGCTTTGCTGATGGTGCTGCTGTC
GATGCTATTGATACCGATGGCGCCCGCGTTGTCGTTCACGAGCTCGAGCCCGGTTGGTGGATCTTGGCCAGCATC
GACTTGACCAAGATGCCGCTTCCCCCGCGTCTTGTCAACTCGGCCGCCGAAGACAGTAGGTTCGAGTATTCGTCG
CGCGAGATGAAGCCGGCGTCGCTGCTCGTCGGAGATCTGCTACGGGCCCATAACATCTTTCTCATGCACCACGGC
TCCTCTCTCAGCGGCCTCTTCGTCCACTGCCGTCGGTCCAAGTTCGTCGCGCTGCTGGGACGGTATTGGGATCTG
TTCCTCTCTACCTGGAACGTGCTGCTGCACGGTAACCCGGCCAGGGACATGTTCGGGGCCATCAACGTGGCCGCC
TCGGGCGAGCTGGGCGTCGGCGTCGGCGAGGAGGACCGTGGTAGTGGCGAGCGCGAGGTTCTCGAGGGCTTGGTC
GGTAGGATAGAGGGCCTGGTCGATCTCGTCGTCTCCAAGTTCGGCACGGATGAGGACGAGTCGGAGCAGGACGTG
TCTTGGCTCGGCACCGGTCGGGAGCCCGCGGCCGATGACGGCGCCGTCTTTCTCGGTGTCGGCGCCTTGTCGAGG
AAATCGTTGAGGGACGTGACGCACTGGATGGAAGACTTGTACACCTGGGGTGAGCATGCCTACGGCGTCATCGAG
AGTCCGACGTCGGTCCGCCGCGCCGGCGCCCGGTGCGGAAGTGCTGCTGCTCATGAGGACGGAGCGGCCACGGAG
GAGCCGTCGGCCGGTGCCGAGGACAAGGCGCCGCCCGCAGAGAGCAAGACGGCGGCTTCCAAGCCCGCAGGCCAA
GCCGACGGCCGGCAATGGACAAAGAATGCCGTCGCCGCCGCCGACGACGGCAGGCTGGACAAGATGCTCAGCTAC
ATGAAGCTCGGCTACGGCTCGTACTGGACCCTCCCCGGGGCCACGAGCCAAGGCACGGCGTCCAGACAGCCGTCG
TCCTCCCGGCGGCCGGCCCCCCCAAAGCGAACCTCATCGGCCGGACGTTTCCTCATCGGCCTCACGGGCCAGATG
GAGGAGACGGATGACGATGGCGACGCAGCCTCGAGCGGCTGCTCCGAGGCCGAGCACAACTCGCGCACCGTCCTG
CGCACCGTCCACGTCGAGCTCGAGAGCGACGGCACGAGGCCCGAGATGACCATGGTCAAGGACTTTGTCAACCCC
GTCAGCGAGCGGCAAGTGGCCTACAGCTCGTACGACGTGAACAAGACGGACAAGCTGCGCGTCGTCATCTACGTC
AACCGGCCCTTCGTCTTCGCCTTCTTCTTCCGCCTGCGCACCGATTCGCTCGCGTGGGACACGCTGTACCGCTCG
CTGCACTACCAGCTGGCTCCGCTGAGGCGTCCGCTGCTGGCGTCGACGCGCTACCGTCCGCCGTCGTCGCAGCCT
CCCGGCGGCCTGTACAGCCTCGTGTGGGACCCGGCTTCGCTGACGGTCCGGGCCGCCGTCCCCAACATACCGGAT
CAGCAGCAGCTCCGGCTCGGCGGCGGCCACTCGTCGCTGCTCGACGCCTTTTGGTCTCGCGCCGATGCCGTCAGC
ACCCATCTCCAGCTGCTGCTGTTGCAGGCCGCCACCCGCTCCGTCACCGGCACCGTCGAGCGCACTCTCAAGACG
AGTCGAGGCTGGTGGATCGTGTGGACGCGTCTCGGCCATGGGGATGACGACGACGACGACGACTGCTCCGCCTCG
GGCCCGGGTCTACCGGCCAAGGAGATTTTTCTCATACGCCGTGCCAGCGACCATGCCGGCGCGGCAGATGCTGTA
GCCGCCGCCGGCTTGGTGCAGGGCATCGGTGTTGATACGCGCCGTTACGTCGAGGAGCTACTGAGCTTGCTG
Transcript >Ophio5|679
ATGGCCTCGGGCGCTGCCTCGTCTTCGGGGGCCGTCGTCCCCGCCCGCCTCGGCTTCCTAGCTATCTACAACCCA
TCGCTGGGCAGGACGGACGAGACGATGGACGAGCAGATCGTCTACTATGCCTCGGTCACGACGCAAGCCGCCTCG
TCTCATCGTCGACGCCGGCGTCGTGTCCGAGCTCGAGCTCGTCCGACGGACGGACTCACGCCCCAAGAGCGCCAT
GAGCGTCTGCGTCAGATCGGCTTGGCTCAGGGCATGGTCAGCTTTGGTCGTGGCTTTGCTGATGGTGCTGCTGTC
GATGCTATTGATACCGATGGCGCCCGCGTTGTCGTTCACGAGCTCGAGCCCGGTTGGTGGATCTTGGCCAGCATC
GACTTGACCAAGATGCCGCTTCCCCCGCGTCTTGTCAACTCGGCCGCCGAAGACAGTAGGTTCGAGTATTCGTCG
CGCGAGATGAAGCCGGCGTCGCTGCTCGTCGGAGATCTGCTACGGGCCCATAACATCTTTCTCATGCACCACGGC
TCCTCTCTCAGCGGCCTCTTCGTCCACTGCCGTCGGTCCAAGTTCGTCGCGCTGCTGGGACGGTATTGGGATCTG
TTCCTCTCTACCTGGAACGTGCTGCTGCACGGTAACCCGGCCAGGGACATGTTCGGGGCCATCAACGTGGCCGCC
TCGGGCGAGCTGGGCGTCGGCGTCGGCGAGGAGGACCGTGGTAGTGGCGAGCGCGAGGTTCTCGAGGGCTTGGTC
GGTAGGATAGAGGGCCTGGTCGATCTCGTCGTCTCCAAGTTCGGCACGGATGAGGACGAGTCGGAGCAGGACGTG
TCTTGGCTCGGCACCGGTCGGGAGCCCGCGGCCGATGACGGCGCCGTCTTTCTCGGTGTCGGCGCCTTGTCGAGG
AAATCGTTGAGGGACGTGACGCACTGGATGGAAGACTTGTACACCTGGGGTGAGCATGCCTACGGCGTCATCGAG
AGTCCGACGTCGGTCCGCCGCGCCGGCGCCCGGTGCGGAAGTGCTGCTGCTCATGAGGACGGAGCGGCCACGGAG
GAGCCGTCGGCCGGTGCCGAGGACAAGGCGCCGCCCGCAGAGAGCAAGACGGCGGCTTCCAAGCCCGCAGGCCAA
GCCGACGGCCGGCAATGGACAAAGAATGCCGTCGCCGCCGCCGACGACGGCAGGCTGGACAAGATGCTCAGCTAC
ATGAAGCTCGGCTACGGCTCGTACTGGACCCTCCCCGGGGCCACGAGCCAAGGCACGGCGTCCAGACAGCCGTCG
TCCTCCCGGCGGCCGGCCCCCCCAAAGCGAACCTCATCGGCCGGACGTTTCCTCATCGGCCTCACGGGCCAGATG
GAGGAGACGGATGACGATGGCGACGCAGCCTCGAGCGGCTGCTCCGAGGCCGAGCACAACTCGCGCACCGTCCTG
CGCACCGTCCACGTCGAGCTCGAGAGCGACGGCACGAGGCCCGAGATGACCATGGTCAAGGACTTTGTCAACCCC
GTCAGCGAGCGGCAAGTGGCCTACAGCTCGTACGACGTGAACAAGACGGACAAGCTGCGCGTCGTCATCTACGTC
AACCGGCCCTTCGTCTTCGCCTTCTTCTTCCGCCTGCGCACCGATTCGCTCGCGTGGGACACGCTGTACCGCTCG
CTGCACTACCAGCTGGCTCCGCTGAGGCGTCCGCTGCTGGCGTCGACGCGCTACCGTCCGCCGTCGTCGCAGCCT
CCCGGCGGCCTGTACAGCCTCGTGTGGGACCCGGCTTCGCTGACGGTCCGGGCCGCCGTCCCCAACATACCGGAT
CAGCAGCAGCTCCGGCTCGGCGGCGGCCACTCGTCGCTGCTCGACGCCTTTTGGTCTCGCGCCGATGCCGTCAGC
ACCCATCTCCAGCTGCTGCTGTTGCAGGCCGCCACCCGCTCCGTCACCGGCACCGTCGAGCGCACTCTCAAGACG
AGTCGAGGCTGGTGGATCGTGTGGACGCGTCTCGGCCATGGGGATGACGACGACGACGACGACTGCTCCGCCTCG
GGCCCGGGTCTACCGGCCAAGGAGATTTTTCTCATACGCCGTGCCAGCGACCATGCCGGCGCGGCAGATGCTGTA
GCCGCCGCCGGCTTGGTGCAGGGCATCGGTGTTGATACGCGCCGTTACGTCGAGGAGCTACTGAGCTTGCTGTGA
Gene >Ophio5|679
ATGGCCTCGGGCGCTGCCTCGTCTTCGGGGGCCGTCGTCCCCGCCCGCCTCGGCTTCCTAGCTATCTACAACCCA
TCGCTGGGCAGGACGGACGAGACGATGGACGAGCAGATCGTCTACTATGCCTCGGTCACGACGCAAGCCGCCTCG
TCTCATCGTCGACGCCGGCGTCGTGTCCGAGCTCGAGCTCGTCCGACGGACGGACTCACGCCCCAAGAGCGCCAT
GAGCGTCTGCGTCAGATCGGCTTGGCTCAGGGCATGGTCAGCTTTGGTCGTGGCTTTGCTGATGGTGCTGCTGTC
GATGCTATTGATACCGATGGCGCCCGCGTTGTCGTTCACGAGCTCGAGCCCGGTTGGTGGATCTTGGCCGTACGT
CTCCAGTGGAACTAAAAGACACAAAACGAGGCTGCATCTCGAGACGTGTTGTGTTGTTGACTTCAGCTTCGAACA
GAGCATCGACTTGACCAAGATGCCGCTTCCCCCGCGTCTTGTCAACTCGGCCGCCGAAGACAGTAGGTTCGAGTA
TTCGTCGCGCGAGATGAAGCCGGCGTCGCTGCTCGTCGGAGATCTGCTACGGGCCCATAACATCTTTCTCATGCA
CCACGGCTCCTCTCTCAGCGGCCTCTTCGTCCACTGCCGTCGGTCCAAGTTCGTCGCGCTGCTGGGACGGTATTG
GGATCTGTTCCTCTCTACCTGGAACGTGCTGCTGCACGGTAACCCGGCCAGGGACATGTTCGGGGCCATCAACGT
GGCCGCCTCGGGCGAGCTGGGCGTCGGCGTCGGCGAGGAGGACCGTGGTAGTGGCGAGCGCGAGGTTCTCGAGGG
CTTGGTCGGTAGGATAGAGGGCCTGGTCGATCTCGTCGTCTCCAAGTTCGGCACGGATGAGGACGAGTCGGAGCA
GGACGTGTCTTGGCTCGGCACCGGTCGGGAGCCCGCGGCCGATGACGGCGCCGTCTTTCTCGGTGTCGGCGCCTT
GTCGAGGAAATCGTTGAGGGACGTGACGCACTGGATGGAAGACTTGTACACCTGGGGTGAGCATGCCTACGGCGT
CATCGAGAGTCCGACGTCGGTCCGCCGCGCCGGCGCCCGGTGCGGAAGTGCTGCTGCTCATGAGGACGGAGCGGC
CACGGAGGAGCCGTCGGCCGGTGCCGAGGACAAGGCGCCGGTGGAATCTGCAGAGAGCAAGGCGGCGGCTTNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGCAGCCCGCAGAGA
GCAAGACGGCGGCTTCCAAGCCCGCAGGCCAAGCCGACGGCCGGCAATGGACAAAGAATGCCGTCGCCGCCGCCG
ACGACGGCAGGCTGGACAAGATGCTCAGCTACATGAAGCTCGGCTACGGCTCGTACTGGACCCTCCCCGGGGCCA
CGAGCCAAGGCACGGCGTCCAGACAGCCGTCGTCCTCCCGGCGGCCGGCCCCCCCAAAGCGAACCTCATCGGCCG
GACGTTTCCTCATCGGCCTCACGGGCCAGATGGAGGAGACGGATGACGATGGCGACGCAGCCTCGAGCGGCTGCT
CCGAGGCCGAGCACAACTCGCGCACCGTCCTGCGCACCGTCCACGTCGAGCTCGAGAGCGACGGCACGAGGCCCG
AGATGACCATGGTCAAGGACTTTGTCAACCCCGTCAGCGAGCGGCAAGTGGCCTACAGCTCGTACGACGTGAACA
AGACGGACAAGCTGCGCGTCGTCATCTACGTCAACCGGCCCTTCGTCTTCGCCTTCTTCTTCCGCCTGCGCACCG
ATTCGCTCGCGTGGGACACGCTGTACCGCTCGCTGCACTACCAGCTGGCTCCGCTGAGGCGTCCGCTGCTGGCGT
CGACGCGCTACCGTCCGCCGTCGTCGCAGCCTCCCGGCGGCCTGTACAGCCTCGTGTGGGACCCGGCTTCGCTGA
CGGTCCGGGCCGCCGTCCCCAACATACCGGATCAGCAGCAGCTCCGGCTCGGCGGCGGCCACTCGTCGCTGCTCG
ACGCCTTTTGGTCTCGCGCCGATGCCGTCAGCACCCATCTCCAGCTGCTGCTGTTGCAGGCCGCCACCCGCTCCG
TCACCGGCACCGTCGAGCGCACTCTCAAGACGAGTCGAGGCTGGTGGATCGTGTGGACGCGTCTCGGCCATGGGG
ATGACGACGACGACGACGACTGCTCCGCCTCGGGCCCGGGTCTACCGGCCAAGGAGATTTTTCTCATACGCCGTG
CCAGCGACCATGCCGGCGCGGCAGATGCTGTAGCCGCCGCCGGCTTGGTGCAGGGCATCGGTGTTGATACGCGCC
GTTACGTCGAGGAGCTACTGAGCTTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail