Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6787
Gene name
Locationscaffold_61:40083..40916
Strand-
Gene length (bp)833
Transcript length (bp)765
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 9.2E-17 77 205

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q91577|CY561_XENLA Cytochrome b561 OS=Xenopus laevis GN=cyb561 PE=2 SV=1 40 172 3.0E-07
sp|Q5RCZ2|CY561_PONAB Cytochrome b561 OS=Pongo abelii GN=CYB561 PE=2 SV=1 40 196 6.0E-07
sp|P49447|CY561_HUMAN Cytochrome b561 OS=Homo sapiens GN=CYB561 PE=1 SV=2 40 196 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 71 93 22
3 114 131 17
4 146 168 22
5 188 207 19
6 212 234 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6787
MASSTGIPARAEPGRLEPSDTEPLLGRPGDVIQRRNTPFARNLIMGTASLAQLGAILMLVLVWASVLNKPLILFS
AHPLLQSLAVFVLIQSVLSLQPTYTSEQKQLGQRVHASLNLVALLLLIAGVTLIEYNKLTSHGPHFHSVHGYLGV
IVSIILIIQYLVGFTMWAVPALYGGEVRARAVWKYHRYSGYVVLLLLLVTVCSAAETDYNRNVLHMKLWAAILAS
ILVVLGVFPRIQKYKLGLGPPAPPREAAH
Coding >Ophio5|6787
ATGGCCAGCTCCACGGGCATCCCCGCGCGGGCCGAGCCCGGTCGCCTTGAGCCCTCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGATGTGATTCAGCGCCGCAACACGCCGTTTGCCCGGAACCTCATCATGGGAACCGCCTCACTC
GCCCAGCTCGGAGCCATTCTCATGCTCGTCCTCGTCTGGGCTTCGGTCCTCAACAAACCGCTGATTCTCTTCTCC
GCGCACCCGCTGCTGCAGTCGCTCGCCGTCTTCGTCCTCATCCAGTCGGTGCTGTCGCTGCAGCCCACGTACACG
AGCGAGCAGAAGCAGCTGGGCCAGCGCGTCCACGCCTCGCTCAATCTCGTTGCCCTTCTTCTGCTCATCGCCGGC
GTGACGCTAATCGAATACAATAAGCTGACATCCCATGGCCCGCACTTTCACTCTGTCCACGGCTATCTCGGCGTC
ATCGTTAGCATCATCCTCATCATCCAGTATCTCGTCGGCTTCACTATGTGGGCTGTCCCGGCTCTGTATGGCGGC
GAGGTGCGCGCCCGTGCCGTGTGGAAATATCACCGTTACTCGGGATACGTGGTGCTCCTGCTGCTACTGGTCACG
GTGTGTAGCGCCGCTGAGACCGACTACAACCGCAACGTGCTGCACATGAAGCTCTGGGCCGCCATTTTAGCCTCG
ATCCTCGTTGTCCTCGGCGTCTTCCCGCGTATTCAGAAATACAAGCTCGGTCTCGGCCCCCCGGCTCCGCCGCGC
GAGGCTGCACAT
Transcript >Ophio5|6787
ATGGCCAGCTCCACGGGCATCCCCGCGCGGGCCGAGCCCGGTCGCCTTGAGCCCTCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGATGTGATTCAGCGCCGCAACACGCCGTTTGCCCGGAACCTCATCATGGGAACCGCCTCACTC
GCCCAGCTCGGAGCCATTCTCATGCTCGTCCTCGTCTGGGCTTCGGTCCTCAACAAACCGCTGATTCTCTTCTCC
GCGCACCCGCTGCTGCAGTCGCTCGCCGTCTTCGTCCTCATCCAGTCGGTGCTGTCGCTGCAGCCCACGTACACG
AGCGAGCAGAAGCAGCTGGGCCAGCGCGTCCACGCCTCGCTCAATCTCGTTGCCCTTCTTCTGCTCATCGCCGGC
GTGACGCTAATCGAATACAATAAGCTGACATCCCATGGCCCGCACTTTCACTCTGTCCACGGCTATCTCGGCGTC
ATCGTTAGCATCATCCTCATCATCCAGTATCTCGTCGGCTTCACTATGTGGGCTGTCCCGGCTCTGTATGGCGGC
GAGGTGCGCGCCCGTGCCGTGTGGAAATATCACCGTTACTCGGGATACGTGGTGCTCCTGCTGCTACTGGTCACG
GTGTGTAGCGCCGCTGAGACCGACTACAACCGCAACGTGCTGCACATGAAGCTCTGGGCCGCCATTTTAGCCTCG
ATCCTCGTTGTCCTCGGCGTCTTCCCGCGTATTCAGAAATACAAGCTCGGTCTCGGCCCCCCGGCTCCGCCGCGC
GAGGCTGCACATTAG
Gene >Ophio5|6787
ATGGCCAGCTCCACGGGCATCCCCGCGCGGGCCGAGCCCGGTCGCCTTGAGCCCTCGGACACGGAGCCTCTCCTC
GGACGGCCCGGCGATGTGATTCAGCGCCGCAACACGCCGTTTGCCCGGAACCTCATCATGGGTACAGCCCAGACC
CTCCCCCTTGTCCCTCCTTCGCTCGCTCGGATGATGCTGACGACAGCTCGCCAGGAACCGCCTCACTCGCCCAGC
TCGGAGCCATTCTCATGCTCGTCCTCGTCTGGGCTTCGGTCCTCAACAAACCGCTGATTCTCTTCTCCGCGCACC
CGCTGCTGCAGTCGCTCGCCGTCTTCGTCCTCATCCAGTCGGTGCTGTCGCTGCAGCCCACGTACACGAGCGAGC
AGAAGCAGCTGGGCCAGCGCGTCCACGCCTCGCTCAATCTCGTTGCCCTTCTTCTGCTCATCGCCGGCGTGACGC
TAATCGAATACAATAAGCTGACATCCCATGGCCCGCACTTTCACTCTGTCCACGGCTATCTCGGCGTCATCGTTA
GCATCATCCTCATCATCCAGTATCTCGTCGGCTTCACTATGTGGGCTGTCCCGGCTCTGTATGGCGGCGAGGTGC
GCGCCCGTGCCGTGTGGAAATATCACCGTTACTCGGGATACGTGGTGCTCCTGCTGCTACTGGTCACGGTGTGTA
GCGCCGCTGAGACCGACTACAACCGCAACGTGCTGCACATGAAGCTCTGGGCCGCCATTTTAGCCTCGATCCTCG
TTGTCCTCGGCGTCTTCCCGCGTATTCAGAAATACAAGCTCGGTCTCGGCCCCCCGGCTCCGCCGCGCGAGGCTG
CACATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail