Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|6784
Gene name
Locationscaffold_61:27978..29467
Strand+
Gene length (bp)1489
Transcript length (bp)1215
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03452 Anp1 Anp1 4.6E-107 101 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74745|ANP1_SCHPO Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anp1 PE=3 SV=1 120 395 3.0E-90
sp|P32629|ANP1_YEAST Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANP1 PE=1 SV=3 88 395 6.0E-90
sp|P23642|VAN1_YEAST Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAN1 PE=1 SV=3 100 395 1.0E-74
sp|Q00314|VAN1_CANAX Vanadate resistance protein OS=Candida albicans GN=VAN1 PE=3 SV=1 100 395 6.0E-72
sp|P53697|MNN9_CANAL Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN9 PE=3 SV=1 102 396 3.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74745|ANP1_SCHPO Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anp1 PE=3 SV=1 120 395 3.0E-90
sp|P32629|ANP1_YEAST Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANP1 PE=1 SV=3 88 395 6.0E-90
sp|P23642|VAN1_YEAST Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAN1 PE=1 SV=3 100 395 1.0E-74
sp|Q00314|VAN1_CANAX Vanadate resistance protein OS=Candida albicans GN=VAN1 PE=3 SV=1 100 395 6.0E-72
sp|P53697|MNN9_CANAL Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNN9 PE=3 SV=1 102 396 3.0E-67
sp|O36022|MNN9_SCHPO Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnn9 PE=3 SV=1 82 394 1.0E-65
sp|P39107|MNN9_YEAST Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNN9 PE=1 SV=3 88 398 1.0E-63
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|6784
MLLPKGGLNWKAAKSRLPPTRALLSVVTRSRFLLLAAVIGALLLLWRGISSSASEMQSFYCWGPSKPPIDMSQNE
YARWHAHLQTPVVFNHHAPLKVESTTIEHVDLNPIKSTRKAIVNEERILILTPLKDAAPYLSKYFELLAELTYPH
HLIDLAFLVSDSQDDTLAVLSSELDRIQKRPDQIPFRNAMVVEKDFDFHLSQNVEERHSFEAQGPRRKAMGRARN
YLLSAALKPEHSWVYWRDVDIVDSPAKILEDFIAHDKDILVPNIWFHRYKDGVDIEGRFDYNSWVESDKGRRLVA
SLDKDVVLAEGYKQYDTGRTYMAKMGDWRDNKDEELELDGIGGVNILVKGDVHRSGINFPCYAFQNQAETEGFAK
MAKQAGYQVYGLPNYIVWHIDTEEKGGNA
Coding >Ophio5|6784
ATGCTTCTTCCCAAGGGCGGCCTGAATTGGAAGGCCGCCAAGTCCAGGCTACCGCCGACGAGAGCGCTGCTGAGC
GTCGTGACGAGAAGCAGGTTCCTGCTGCTGGCTGCCGTCATCGGCGCCCTTTTGCTCCTATGGCGCGGCATTAGC
AGCTCTGCTTCGGAGATGCAGAGCTTCTACTGCTGGGGTCCGTCCAAGCCGCCGATAGACATGTCGCAGAACGAG
TACGCGAGGTGGCATGCGCATCTGCAGACGCCCGTCGTCTTCAACCATCACGCACCGCTCAAGGTGGAATCGACG
ACGATAGAACATGTCGACCTCAACCCCATCAAGTCGACGAGAAAGGCCATTGTCAACGAGGAGAGGATTCTCATC
CTGACGCCCCTCAAGGACGCGGCCCCGTACCTGTCCAAGTATTTTGAACTTCTCGCCGAGTTGACGTATCCGCAC
CACCTCATCGACCTCGCCTTTCTCGTCTCCGACTCCCAAGACGACACCCTCGCCGTCCTCTCGTCCGAACTCGAC
CGAATTCAGAAGCGGCCTGATCAGATCCCGTTCCGCAATGCAATGGTCGTCGAGAAGGATTTCGACTTTCATCTG
AGCCAGAATGTCGAGGAGAGGCACTCGTTTGAAGCCCAGGGTCCCCGTCGCAAGGCCATGGGCAGGGCCAGGAAT
TATCTCCTGTCCGCAGCCCTGAAGCCGGAACACTCGTGGGTCTACTGGCGCGACGTCGATATCGTGGACAGTCCA
GCCAAGATATTGGAGGACTTTATCGCCCACGACAAGGACATACTTGTTCCGAACATTTGGTTTCACCGATACAAG
GACGGCGTTGACATTGAAGGACGATTCGATTACAACTCGTGGGTCGAGTCAGACAAGGGTCGTCGGCTGGTGGCG
AGCCTGGACAAGGACGTCGTGCTCGCCGAGGGATACAAGCAGTATGACACCGGTCGCACGTACATGGCCAAGATG
GGCGACTGGCGGGACAACAAGGACGAGGAGCTCGAGCTCGACGGCATTGGCGGCGTCAACATTCTCGTCAAGGGA
GACGTGCATCGATCAGGCATCAACTTCCCATGCTACGCCTTCCAGAACCAAGCCGAGACGGAAGGATTCGCCAAG
ATGGCAAAGCAGGCAGGCTACCAGGTCTACGGACTGCCGAATTACATTGTGTGGCATATCGATACGGAGGAGAAG
GGCGGAAACGCG
Transcript >Ophio5|6784
ATGCTTCTTCCCAAGGGCGGCCTGAATTGGAAGGCCGCCAAGTCCAGGCTACCGCCGACGAGAGCGCTGCTGAGC
GTCGTGACGAGAAGCAGGTTCCTGCTGCTGGCTGCCGTCATCGGCGCCCTTTTGCTCCTATGGCGCGGCATTAGC
AGCTCTGCTTCGGAGATGCAGAGCTTCTACTGCTGGGGTCCGTCCAAGCCGCCGATAGACATGTCGCAGAACGAG
TACGCGAGGTGGCATGCGCATCTGCAGACGCCCGTCGTCTTCAACCATCACGCACCGCTCAAGGTGGAATCGACG
ACGATAGAACATGTCGACCTCAACCCCATCAAGTCGACGAGAAAGGCCATTGTCAACGAGGAGAGGATTCTCATC
CTGACGCCCCTCAAGGACGCGGCCCCGTACCTGTCCAAGTATTTTGAACTTCTCGCCGAGTTGACGTATCCGCAC
CACCTCATCGACCTCGCCTTTCTCGTCTCCGACTCCCAAGACGACACCCTCGCCGTCCTCTCGTCCGAACTCGAC
CGAATTCAGAAGCGGCCTGATCAGATCCCGTTCCGCAATGCAATGGTCGTCGAGAAGGATTTCGACTTTCATCTG
AGCCAGAATGTCGAGGAGAGGCACTCGTTTGAAGCCCAGGGTCCCCGTCGCAAGGCCATGGGCAGGGCCAGGAAT
TATCTCCTGTCCGCAGCCCTGAAGCCGGAACACTCGTGGGTCTACTGGCGCGACGTCGATATCGTGGACAGTCCA
GCCAAGATATTGGAGGACTTTATCGCCCACGACAAGGACATACTTGTTCCGAACATTTGGTTTCACCGATACAAG
GACGGCGTTGACATTGAAGGACGATTCGATTACAACTCGTGGGTCGAGTCAGACAAGGGTCGTCGGCTGGTGGCG
AGCCTGGACAAGGACGTCGTGCTCGCCGAGGGATACAAGCAGTATGACACCGGTCGCACGTACATGGCCAAGATG
GGCGACTGGCGGGACAACAAGGACGAGGAGCTCGAGCTCGACGGCATTGGCGGCGTCAACATTCTCGTCAAGGGA
GACGTGCATCGATCAGGCATCAACTTCCCATGCTACGCCTTCCAGAACCAAGCCGAGACGGAAGGATTCGCCAAG
ATGGCAAAGCAGGCAGGCTACCAGGTCTACGGACTGCCGAATTACATTGTGTGGCATATCGATACGGAGGAGAAG
GGCGGAAACGCGTGA
Gene >Ophio5|6784
ATGCTTCTTCCCAAGGGCGGCCTGAATTGGAAGGCCGCCAAGTCCAGGCTACCGCCGACGAGAGCGCTGCTGAGC
GTCGTGACGAGAAGCAGGTTCCTGCTGCTGGCTGCCGTCATCGGCGCCCTTTTGCTCCTATGGCGCGGCATTAGC
AGCTCTGCTTCGGAGATGCAGAGGTGTGAAGGGCCCCCCTAGCCGCCTTGCATCCTTGGCTGCTGACAACTTTTA
GCTTCTACTGCTGGGGTCCGTCCAAGCCGCCGATAGACATGTCGCAGAACGAGTACGCGAGGTGGCATGCGCATC
TGCAGACGCCCGTCGTCTTCAACCATCACGCACCGCTCAAGGTGGAATCGACGACGATAGAACATGTCGACCTCA
ACCCCATCAAGTCGACGAGAAAGGCCATTGTCAACGAGGAGAGGATTCTCATCCTGACGCCCCTCAAGGACGCGG
CCCCGTACCTGTCCAAGTATTTTGAACTTCTCGCCGAGTTGACGTATCCGCACCACCTCATCGACCTCGCCTTTC
TCGTCTCCGACTCCCAAGACGACACCCTCGCCGTCCTCTCGTCCGAACTCGACCGAATTCAGAAGCGGCCTGATC
AGATCCCGTTCCGCAATGCAATGGTCGTCGAGAAGGATTTCGACTTTCATCTGAGCCAGAATGTCGAGGAGAGGC
ACTCGTTTGAAGCCCAGGGTCCCCGTCGCAAGGCCATGGGCAGGGCCAGGAATTATCTCCTGTCCGCAGCCCTGA
AGCCGGAACACTCGTGGGTCTACTGGCGCGACGTCGATATCGTGGACAGTCCAGCCAAGATATTGGAGGACTTTA
TCGCCCACGACAAGGACATACTTGTTCCGAGTAGGAAAAGCCACACCCGCCGCCACGAGACCCGCTAACCGGAGC
TCCAGACATTTGGTTTCACCGATACAAGGACGGCGTTGACATTGAAGGACGATGTGAGTCTCGGACGAGCCGGCC
GGCCGGCTGAGTGACGTTTGGACTAACGCGGACGCGAACAGTCGATTACAACTCGTGGGTCGAGTCAGACAAGGG
TCGTCGGCTGGTGGCGAGCCTGGACAAGGACGTCGTGCTCGCCGAGGGTTTGTCGCCCGAGCTGGAGCTGCGAGT
GCTACCGATACTGATGGGCGTGCAGGATACAAGCAGTATGACACCGGTCGCACGTACATGGCCAAGATGGGCGAC
TGGCGGGACAACAAGGACGAGGAGCTCGAGCTCGACGGCATTGGCGGCGTCAACATTCTCGTCAAGGGAGACGTG
CATCGATCAGGTACGCTCCAGATACGGGTTCGTGGCGAGCGTTGGGCGCTGACGTCCGAGTGCAGGCATCAACTT
CCCATGCTACGCCTTCCAGAACCAAGCCGAGACGGAAGGATTCGCCAAGATGGCAAAGCAGGCAGGCTACCAGGT
CTACGGACTGCCGAATTACATTGTGTGGCATATCGATACGGAGGAGAAGGGCGGAAACGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail